KEGG   Selaginella moellendorffii: SELMODRAFT_82317Help
Entry
SELMODRAFT_82317  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
smo  Selaginella moellendorffii
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:smo04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 172 aa AA seqDB search
SPTMMEEFLALARHNTQKNLETCGVLAGFLEKGMFSVTTLIIPKQEATSDSCQTVNEEEL
FEVQDKRNLFQLGWIHTHPTQTCFMSSIDLHTHYSYQVMLQEAIAIVMAPTDEERSFGIF
RLSEPGGMEAIQQCDQRGFHPHDEPANGGSIYDHCSHVYMNPSLRFDIVDLR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
tctccgactatgatggaagagttccttgcactagctcgtcacaatacgcaaaagaatttg
gaaacctgcggagtcctggccggttttcttgaaaagggtatgttttctgtgacaactctg
attatcccgaagcaggaagcgacgtcagattcgtgccaaacggtcaacgaggaggaacta
ttcgaagttcaagacaaacggaatctattccagcttggatggatacacacgcatccaaca
caaacgtgttttatgtcgtcaatagatcttcacacgcactactcctaccaggtaatgctg
caggaggcaattgcgatcgtcatggctcccaccgacgaagaaaggtccttcggcattttt
cggctgtccgagcctggcggcatggaagctatccagcagtgcgaccaacgaggatttcat
ccacacgacgagccggccaacggcggctccatatacgatcactgttcccatgtctacatg
aatcccagcttaagattcgatatagtcgacttgaggtaa

DBGET integrated database retrieval system