KEGG   Selaginella moellendorffii: SELMODRAFT_82767Help
Entry
SELMODRAFT_82767  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 380 aa AA seqDB search
MSEDVDKHVLRKYHVCQKLGKGAYGIVWKAFDRKTNDVVALKKIFDAFQNSTDAQRTFRE
VMFLQEINDHENVIKLTNVLKAENDRDLYLVFEYMETDLHAVIRANILEDVHKQYIMYQL
FKSLKYLHSAGLLHRDIKPSNLLLDSDCRCKLADFGLARSVAQLKDDMGQAQVLTDYVAT
RWYRAPEILLGSTNYTFGVDMWSSGCILGELLNGKPVFPGASTMNQIEKVLDLIGKPASE
DIAAFESPFAAAMIENMAITGPSRSFRKAFPSATPEAADLLRKLLHFNPQKRLTAEQALQ
HPYVAQFHNPREEPSCNRLIRIPIDDNHKFTIHEYRERLYAEIISRKKEIRKKARERERS
LHREMSRMQSRRSSYHPRAS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggacgtcgacaagcacgtcttgcggaagtaccacgtttgccaaaagctcggc
aagggtgcttatggaatcgtttggaaagcgtttgataggaagaccaacgatgttgttgct
ctcaaaaagatatttgacgcgtttcaaaactcgactgatgctcagaggacctttcgcgag
gtgatgtttcttcaggagatcaacgatcatgagaacgtcatcaagttgacaaacgttctc
aaagcggaaaatgaccgtgacttgtacctagtgtttgagtacatggaaacggatttgcat
gctgttataagagccaatattctcgaggatgtacataaacaatacatcatgtatcaactc
tttaaatctttgaagtatttgcacagcgcaggactgctgcatcgagatatcaagccaagc
aatctacttttggattcggattgccgatgcaagcttgcagattttggtttggcacgatcg
gttgcccaattgaaagatgacatgggacaagcgcaagtgctaacagactatgttgctact
cgatggtatagagcacccgagattcttcttggttccacaaactacacctttggagtggac
atgtggtcgagtggctgcattcttggcgagttgttgaacgggaagcctgtttttccaggg
gcatcgactatgaaccagattgaaaaagttctggatctaataggaaaaccggcatcggag
gacatagcagctttcgaatcgccatttgctgcagctatgattgagaacatggctataact
ggccccagcagatcatttagaaaagctttccccagcgccacgcctgaagctgcggactta
ctacgcaaattgctacactttaatcctcagaagaggcttacagcggagcaagcattgcaa
catccatacgtagctcaatttcacaaccctcgtgaggagccatcgtgcaatcgattgatc
aggattcccattgacgacaatcataaattcacgatccacgagtatcgggaaaggctatac
gccgaaatcatcagccggaagaaagagatcaggaagaaggctcgagagcgagaacggagc
ctccacagagagatgtcaagaatgcaatcgagacgctcgtcttaccatcccagagcaagt
tag

DBGET integrated database retrieval system