KEGG   Selaginella moellendorffii: SELMODRAFT_83442Help
Entry
SELMODRAFT_83442  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
smo  Selaginella moellendorffii
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:smo00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smo00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 329 aa AA seqDB search
MTRRSKIHPAEQQGGDDFIPRAIGGDGLLKFLVVDQSSLLSSQTAGVFRSIQAAIDAVPV
GNQHWVIIQVGAGVYQEKITIPYMKPYILLQGAGRDFTTISWSDSASTFGTANSATFSAF
APNFIAKYISFRNNAPRPPPGAFNRQAVAVLVAGDMAAFYSCGFYGAQDTLFDYEGRHYF
RDCYIEGSIDFIFGHAKSVFKACELHAIADSFGSVTAQNRGDPRENSGFIFIACTVTGSG
TIFLGRAWGAYSRVVYLFTYMDSNVVSEGWNDWGVASRQQTVYYGQYKCFGPGANELGRV
RWSHELTDEEARPFLQVNFIDGVQWLREL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggaggagcaagatccacccggcggagcagcagggcggcgacgatttcatcccg
agagcaatcggcggcgatgggctgctcaagttcttggtggtcgaccaaagctccctccta
tcgtcgcagacggcgggagttttcaggtccatccaagcagcaatcgatgccgtcccggtt
gggaaccagcattgggtgatcatccaagttggagctggagtttaccaggagaagatcacg
attccatacatgaagccttacattcttctccaaggtgccgggagagatttcaccaccatc
tcctggagcgactcggccagcactttcgggactgccaacagcgctactttcagcgccttt
gctccgaatttcatcgccaagtacatcagcttcaggaacaatgcaccacggccgccaccg
ggagctttcaatcgccaagcggtggctgttttggtcgccggcgacatggctgccttctac
tcgtgtggcttctatggcgcccaggacacgctcttcgattacgagggacgtcactacttc
cgggactgctacatcgaaggctccattgactttatcttcggccatgcgaagtccgtcttc
aaggcctgtgagctccacgccatcgccgacagctttggctcagtcaccgctcagaacagg
ggagaccctcgcgagaactctggcttcatatttattgcctgcacagtgacaggaagtggc
accattttcttaggacgagcttggggagcttactctcgagtcgtctatctcttcacctac
atggacagcaacgttgtctccgaggggtggaatgattggggcgtcgcgagcaggcagcag
acagtttattatggtcagtacaagtgtttcggaccgggagctaacgaactaggccgtgtt
cggtggtctcacgagctcacggacgaggaagccaggcctttcctgcaagtaaacttcatt
gacggcgtacaatggttacgtgaactatag

DBGET integrated database retrieval system