KEGG   Selaginella moellendorffii: SELMODRAFT_84957Help
Entry
SELMODRAFT_84957  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SELMODRAFT_84957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 432 aa AA seqDB search
MPPAKDRVSYFYDGDVGSVYYGPNHPMKPHRLCMTHSLVLAYGLHNKMEIYRPRKAYPAE
LAQFHSTDYIDFLHRITPEMQDQYAKELLMYNMGEDCPVFDNLFEFCQIYAGGTIADAAH
RLNHGLCDIAINWAGGLHHAKKCEASGFCYVNDLVLGILELLKYFPRVLYIDIDIHHGDG
VEEAFYLTDRVMTVSFHKFGDYFFPGTGDVKDVGEREGKYYAVNVPLKDGIDDSSFIRLF
RVVISKVVEFYQPGAVVLQCGADSLAGDRLGCFNLSIQGHAECVNFVKKLGIPLLVTGGG
GYTKENVARCWTVETGVLLDTELPNEIPSNDYIKYFKPDYTLKTNHGLNLDNLNTKAYLS
AIKMQVLENLRHIQHAPGVQMHEVPPDTYFPDFDEEDFNPDERLDQHTQDKSVQRDEEFY
DGDNDNDHDMDS
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgccaccggcgaaggatcgagtgtcctacttctacgacggtgatgttggaagcgtctac
tatggaccgaatcatccgatgaagccccatcgcttgtgtatgacgcatagccttgttcta
gcttatggcctccacaacaagatggaaatctatagacctcggaaagcttatcccgcggag
cttgcgcagttccattctacagactacattgattttcttcacagaataactccagaaatg
caagaccaatacgcgaaagagcttcttatgtataacatgggagaagattgtccagtcttt
gacaacctcttcgagttctgccagatttacgcgggtggtaccattgcagatgctgcacat
aggcttaatcacggactctgcgacattgcaatcaactgggccggaggcttgcaccacgcc
aagaagtgcgaggcatcgggattctgctatgtcaatgacttggttcttgggattttggag
cttctgaagtacttcccgcgagtgctatacatagatatcgatattcaccatggagacggc
gttgaagaagccttctacctcactgacagagtaatgactgtgagctttcacaagttcggt
gattatttctttcctggaactggggacgtgaaggatgttggagagagagaagggaaatat
tacgctgttaatgttcctcttaaagatggaatagacgactcaagcttcatacggctgttt
cgagtagtaatatcaaaagtcgttgagttctatcaacctggggcggtggtgctgcaatgt
ggagctgattcgcttgctggagatcgcctaggatgctttaatctttccattcaagggcat
gcggagtgcgtgaattttgtgaagaaacttggcattcctctcctggtaaccggtggagga
ggatacaccaaggaaaatgttgcgcgttgctggaccgtggaaacgggtgtgcttttggat
acggagcttccgaatgaaataccgtccaacgattatatcaagtatttcaagcccgactac
accttgaaaaccaatcacggactcaacctggataacttgaatacaaaggcttatctcagc
gccataaaaatgcaagtgctggaaaatcttcgtcatatacagcatgctccaggggttcag
atgcatgaggttccgccagacacctacttcccagacttcgacgaggaggattttaatccc
gatgagcgactagaccaacatacgcaagataaaagtgtgcagcgtgacgaagagttttac
gatggcgacaacgataatgaccatgacatggattcgtga

DBGET integrated database retrieval system