KEGG   Selaginella moellendorffii: SELMODRAFT_85784Help
Entry
SELMODRAFT_85784  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smo  Selaginella moellendorffii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:smo00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:smo00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 414 aa AA seqDB search
MAAEEVLNAQYGGFQRPDAFGRFGKFGGKYVPETLMTALADLEAAYRLLVVKPEFQQELA
GILKDYVGRETPLYFAERLTQFYKNANGTGPDIYLKREDLNHTGAHKINNAVGQALLAKH
IGKKRIIAETGAGQHGVATATVCARFGLECVVYMGAQDMERQALNVFRMRLLGAEVRPVH
SGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHTVIGKETRRQALEKW
NGKPDVLVACVGGGSNAMGLFHEFVNDNDVRLVGVEAAGFGLDSGKHAATLTKGEVGVLH
GAMSYLLQDEDGQIIEPHSISAGLDYPGVGPEHSFLKDMGRAEYHSVTDAEALEAFQRLS
RLEGIIPALETSHALAFLETLCPTLEDGCKVVVNCSGRGDKDVQSAIKYLKFEA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggaggaggtgttgaatgcgcagtatggaggattccagcggccggacgcattt
gggaggtttggaaaatttggtgggaagtatgtgccggagacgctcatgacggcgctggcg
gatttggaggccgcttatcgattgctcgttgtgaagcccgaattccagcaagaactggcc
ggcattctcaaggactatgttggtcgagagacacctctctacttcgcggagcgcttgact
cagttctacaagaatgccaatggcactggaccagatatctatctcaagcgagaggatcta
aatcacactggtgctcacaagatcaacaatgccgttggccaggccttgctcgcaaaacac
atcggcaagaagcgaattattgccgagactggagccggccagcacggagtcgccaccgcc
actgtctgtgcgcgatttggattagaatgcgtcgtctacatgggtgcgcaagacatggag
aggcaagctctcaacgttttccgtatgcgactcctcggtgccgaggtccggcctgttcac
tcgggcactgctactttaaaagatgcaacttcggaagctatccgagactgggtgacgaat
gtcgaaacgacgcactatatcctgggctctgtcgctggtcctcatccatatccaatgctg
gtgagggacttccataccgtgatcgggaaggagacccggcggcaagctctggaaaaatgg
aatggcaagccggacgtgctcgtagcttgcgtcggaggtggctccaacgccatgggcctg
ttccacgagtttgtgaacgacaacgatgtccggctagtgggagtggaggctgctggcttt
ggcttggacagtggcaagcacgcggcaacactgaccaagggagaagtaggagttcttcat
ggagctatgagctacttgctacaggatgaagatggccagatcatcgagccacattctatc
agcgccgggctggactatcctggtgttgggccggagcatagcttcttgaaggacatgggc
cgcgcggaatatcacagtgtgacagatgccgaggccttggaagctttccaaaggttatca
aggcttgaaggtataatccctgcgctggagacctcgcacgctctagcgtttctggagact
ctgtgcccgactctggaagatggttgcaaggtagtagtgaactgcagtggtcggggtgac
aaggatgtccagagcgccatcaaatacctcaagtttgaagcttag

DBGET integrated database retrieval system