KEGG   Selaginella moellendorffii: SELMODRAFT_85956Help
Entry
SELMODRAFT_85956  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
smo  Selaginella moellendorffii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SELMODRAFT_85956
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SELMODRAFT_85956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 420 aa AA seqDB search
MALSFQIAASAATTPPSSSLSSSRKPRLSPVILVPGAGGNQLEVKLGGDYHGSRFVCRTF
GFSHWFRLWLNVLGIIPPFTPCFAERIRLEYNGGSKKFHNPPGITTRVPGFGSTETMEYL
DPTFKFLSGYMNSLVAALKAKGYESQKTLFGAPYDFRYAPGPNAAEVALQFLQDLKNLVE
KASRSNKNTPVTLISHSLGGLWVLHFLNLQSSTWKKRFIHRFIAVSAPWGGSVQEMRVFA
SGYTEGANFLDPLVLRDEQRSSESNLWLLPSPKVFGNKTLVVGSSRNYTATDLEDFFHDI
GYSRGYEHYKTRVPGLLEELAAPGVPVSLVFGVGVDTPETLVYEKQGFDYQPKMEYGDGD
GTINLCSLRWVVDSWKKVGDQQVKVVELQGKTHTTVLKDEDAVEEIVKQLGDVEGQNLSS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctctctccttccagatcgctgcctcggccgctacaactcctccaagttcttcgctt
tcctcttctaggaaacctaggctctctccggtgatcttggtgcctggagctggagggaac
cagctggaagttaagcttggtggagattatcatggtagtcgctttgtgtgtaggactttt
gggttctcgcattggttccggctatggctcaatgttcttggcatcattcctccattcaca
ccatgctttgccgagaggataaggctcgagtacaatggcgggagtaagaagtttcacaat
cctcctgggatcacgaccagagttcctgggtttggttccaccgagacgatggagtacctc
gatccaaccttcaagtttctatctggctacatgaattctttggtggcagcactgaaagcc
aaaggctacgagtcccagaaaactctctttggagctccatacgactttcgctacgctccg
gggccaaacgcagcggaagtggcactccagttcctccaagacttgaaaaacttggtggag
aaagcctcgagatcaaacaagaacacgccagtgacgctaatctctcacagcctcggtggt
ctctgggtgctccactttctcaacttacagagctccacctggaagaagagattcatccat
cgcttcatcgcagtgtcagctccatggggtggctccgtccaagagatgcgagtctttgcc
tctggatacaccgaaggggccaactttctggatcctctcgtgctgcgagacgagcaaagg
agcagcgagagcaacctttggctgctgccatcgcccaaagtttttggaaacaagacgctg
gtggtgggatcgtcaaggaattacacggcgacggatctggaggacttcttccacgatatt
gggtactcgaggggatacgagcactacaagacgagagttcccggactcttggaagaactg
gctgctccaggggttccagtgagcttggtttttggcgttggagtggacacaccggagact
ctggtgtatgagaaacagggatttgattaccagcccaagatggagtatggagatggagac
gggacgatcaacttgtgcagcttgagatgggtggtggattcgtggaaaaaagtcggggac
caacaagtaaaggtggtggaacttcaagggaagacacacacgacggttttgaaggacgag
gatgcagtggaagagattgtcaaacaattaggtgatgtcgaaggacaaaacttaagttca
tag

DBGET integrated database retrieval system