KEGG   Selaginella moellendorffii: SELMODRAFT_86180Help
Entry
SELMODRAFT_86180  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
smo  Selaginella moellendorffii
Pathway
smo00280  Valine, leucine and isoleucine degradation
smo00410  beta-Alanine metabolism
smo00640  Propanoate metabolism
smo01100  Metabolic pathways
smo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SELMODRAFT_86180
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SELMODRAFT_86180
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SELMODRAFT_86180
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     SELMODRAFT_86180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 DEC-1_C
Motif
Other DBs
NCBI-GeneID: 9633678
NCBI-ProteinID: XP_002966249
JGI: 86180
UniProt: D8R690
Position
Unknown
AA seq 363 aa AA seqDB search
MVGLLIFNTLTSVAYCVQIVRLQELYQRWEADSNVVAVILKGNGRAFCAGGDVASVCELG
RQGNLRRQHQASGFFYKEYVLNYYLATFKKPHVAFLNGVVMGGGNGVSVHGKYRVATEKT
LFAMPETALGLHPDVGASYFLSRLDGHLGEYLGLTGERLDGADMLNIGLATHYVPSERLA
SLESELRSVSSPESVEETLGKFSGRPPVQGKSCLHRLQVINACFSGDTVEGILHALERER
GDGDDEWLDKATSKLKGASPTSLKITLASIRRGRQESLAECLAREYRMSFRAVSAKYSGD
FYEGCRAILIDKDNRPRWDPSKLEGVSREVVEGYFAALGDGEGGELQLPVGERGAGARSR
ARI
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcttactcatcttcaacacactcacgtcagtggcctactgtgtgcagatcgtc
cgccttcaagaactctaccagaggtgggaagccgacagcaacgttgtcgcagtcatcctg
aagggcaatgggagggctttctgcgccggcggtgatgttgcaagtgtttgtgaacttggt
cgtcagggtaacctacgtcgccaacaccaggccagtggattcttttacaaggaatacgta
ctcaactattaccttgcgacattcaagaagccgcatgtggcctttctcaacggggtcgtc
atgggtggcgggaatggcgtctccgttcatggcaagtatcgcgttgccacagagaaaact
ctgtttgctatgccggagactgccctcggactgcatcccgacgttggagcatcgtatttt
ctgtctcgtttggatgggcatttgggggagtatctggggttgacgggcgagcgtcttgat
ggagctgacatgctcaacattgggctcgcaacacattatgtgccgtcggagcggctagca
tctctagaaagcgagctgcgcagtgtgtcctcgccagagagcgtggaagaaacactcggg
aaattctcgggcaggccgccggtgcagggaaagagctgcttgcacaggctgcaggtgatc
aatgcttgcttctcgggagacacggtggaaggcattctacatgcattggaaagggagcgg
ggcgacggcgacgatgagtggctggacaaggccacgagcaagctcaagggagcatctccg
acgagcctcaagatcaccctggcatcgattcgtagaggcaggcaggagtccctcgccgag
tgcctggcaagggagtaccgcatgagcttccgtgcggtgtcggcaaagtactcgggagac
ttttacgaggggtgccgggcgatcctgatagacaaggacaaccggccgcggtgggatccc
agcaagctcgagggcgtgtcgcgcgaggtggtggagggctattttgcggcgctgggcgac
ggggaagggggggagctgcagctgccggttggcgagcggggcgcgggagctcggtctcgt
gctcggatttga

DBGET integrated database retrieval system