KEGG   Selaginella moellendorffii: SELMODRAFT_86180Help
Entry
SELMODRAFT_86180  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
smo  Selaginella moellendorffii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SELMODRAFT_86180
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SELMODRAFT_86180
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SELMODRAFT_86180
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SELMODRAFT_86180
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     SELMODRAFT_86180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 363 aa AA seqDB search
MVGLLIFNTLTSVAYCVQIVRLQELYQRWEADSNVVAVILKGNGRAFCAGGDVASVCELG
RQGNLRRQHQASGFFYKEYVLNYYLATFKKPHVAFLNGVVMGGGNGVSVHGKYRVATEKT
LFAMPETALGLHPDVGASYFLSRLDGHLGEYLGLTGERLDGADMLNIGLATHYVPSERLA
SLESELRSVSSPESVEETLGKFSGRPPVQGKSCLHRLQVINACFSGDTVEGILHALERER
GDGDDEWLDKATSKLKGASPTSLKITLASIRRGRQESLAECLAREYRMSFRAVSAKYSGD
FYEGCRAILIDKDNRPRWDPSKLEGVSREVVEGYFAALGDGEGGELQLPVGERGAGARSR
ARI
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcttactcatcttcaacacactcacgtcagtggcctactgtgtgcagatcgtc
cgccttcaagaactctaccagaggtgggaagccgacagcaacgttgtcgcagtcatcctg
aagggcaatgggagggctttctgcgccggcggtgatgttgcaagtgtttgtgaacttggt
cgtcagggtaacctacgtcgccaacaccaggccagtggattcttttacaaggaatacgta
ctcaactattaccttgcgacattcaagaagccgcatgtggcctttctcaacggggtcgtc
atgggtggcgggaatggcgtctccgttcatggcaagtatcgcgttgccacagagaaaact
ctgtttgctatgccggagactgccctcggactgcatcccgacgttggagcatcgtatttt
ctgtctcgtttggatgggcatttgggggagtatctggggttgacgggcgagcgtcttgat
ggagctgacatgctcaacattgggctcgcaacacattatgtgccgtcggagcggctagca
tctctagaaagcgagctgcgcagtgtgtcctcgccagagagcgtggaagaaacactcggg
aaattctcgggcaggccgccggtgcagggaaagagctgcttgcacaggctgcaggtgatc
aatgcttgcttctcgggagacacggtggaaggcattctacatgcattggaaagggagcgg
ggcgacggcgacgatgagtggctggacaaggccacgagcaagctcaagggagcatctccg
acgagcctcaagatcaccctggcatcgattcgtagaggcaggcaggagtccctcgccgag
tgcctggcaagggagtaccgcatgagcttccgtgcggtgtcggcaaagtactcgggagac
ttttacgaggggtgccgggcgatcctgatagacaaggacaaccggccgcggtgggatccc
agcaagctcgagggcgtgtcgcgcgaggtggtggagggctattttgcggcgctgggcgac
ggggaagggggggagctgcagctgccggttggcgagcggggcgcgggagctcggtctcgt
gctcggatttga

DBGET integrated database retrieval system