KEGG   Selaginella moellendorffii: SELMODRAFT_87313Help
Entry
SELMODRAFT_87313  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00051  Fructose and mannose metabolism
smo00562  Inositol phosphate metabolism
smo00710  Carbon fixation in photosynthetic organisms
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
smo01230  Biosynthesis of amino acids
Module
smo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smo_M00002  Glycolysis, core module involving three-carbon compounds
smo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_87313
   00051 Fructose and mannose metabolism
    SELMODRAFT_87313
   00562 Inositol phosphate metabolism
    SELMODRAFT_87313
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SELMODRAFT_87313
Enzymes [BR:smo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SELMODRAFT_87313
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SELMODRAFT_87313
  Exosomal proteins of bladder cancer cells
   SELMODRAFT_87313
  Exosomal proteins of melanoma cells
   SELMODRAFT_87313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 9631859
NCBI-ProteinID: XP_002967330
JGI: 87313
UniProt: D8QR59
Position
Unknown
AA seq 254 aa AA seqDB search
MPRKFCVGGNWKCNGTVEEIKKIVNTLNAAADVPGEDVVEVVIGPPFVYIPLVKSILRPD
FAIAGQNCWVKKGGAFTGEISAEMFKDLAIPWVILGHSERRALCGESNEFVADKVVYALS
QGLKVMACVGETLQQRESGQTNDVVAAQTKAIADKVKDWKNVVIAYEPVWAIGTGKVATP
AQAQEVHAALRSWLEKNVSSDVASKTRILYGGSVTAANCVEIGSQPDVDGFLVGGAALKP
EFVDIIKAANVKKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcaagttttgtgtcggtggcaactggaaatgcaacggaactgtggaggagatc
aagaagattgttaatactttgaatgcagctgccgatgttcctggagaggatgttgttgag
gtggtcatcggcccgccatttgtttatattcccctcgtcaagagcattctccgcccggac
ttcgccatcgccggacaaaactgctgggtgaagaaaggtggagctttcactggcgagatc
agtgccgagatgtttaaggacttggcgatcccgtgggttatcttgggacactccgaaaga
agagctttgtgtggagagagcaatgagtttgttgcagacaaggttgtttacgcattgagt
caagggctcaaagtcatggcctgcgtgggtgaaacgctccagcaaagagaatccggccaa
acaaacgacgttgttgctgctcaaaccaaggcgattgcagacaaggtcaaggactggaag
aatgtggtgatagcatacgagccagtgtgggcgattggaacaggaaaagttgccacccct
gcgcaggctcaggaggtccatgccgcacttcgctcctggctggagaagaatgtcagctct
gatgtagcaagcaagacgaggatactctacggaggttctgtgacagcagccaactgcgtg
gaaatcggctcgcagccggatgtggatggattcctcgttggtggcgctgctctcaagccc
gagttcgtcgacatcatcaaggcagctaacgtgaagaagaagtag

DBGET integrated database retrieval system