KEGG   Selaginella moellendorffii: SELMODRAFT_87493Help
Entry
SELMODRAFT_87493  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
smo  Selaginella moellendorffii
Brite
Chromosome and associated proteins [BR:smo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    SELMODRAFT_87493
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SELMODRAFT_87493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa RP-C Gp_dh_C Lyase_8
Motif
Other DBs
NCBI-GeneID: 9632135
NCBI-ProteinID: XP_002967418
JGI: 87493
UniProt: D8R882
Position
Unknown
AA seq 146 aa AA seqDB search
MAPKGEKKPASKAPAEKKPVEKKPRGAAAADKDGSGGGGGGVAAAAMKKKRMKKATETYK
SYIFKVLKQVHQEIGISSKAMGIMNSFINDIFEKLAQEAARLARYNKKPTITSREIQTAV
RLILPGELAKHAVSEGTKAVTKFTSA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaagggagagaagaagcccgcgagcaaagcccccgcggagaagaagcccgtg
gagaagaagccccggggggcggcagcggcggacaaggatggatccggcggcggcggtggc
ggagtggcggcggcggcgatgaagaagaagcgcatgaaaaaggcgacggagacgtacaag
agctacattttcaaggtgctcaagcaggtccaccaggagattgggatctcgagcaaggcc
atggggatcatgaacagcttcatcaatgatatctttgagaagctcgcgcaggaggcggcg
cggctggcgcgctacaacaagaagcccaccatcacgtcgcgcgagatccagaccgccgtg
aggctcatcctccccggcgagctcgccaagcacgctgtgagcgaggggaccaaggcggtc
accaagttcacgagcgcgtag

DBGET integrated database retrieval system