KEGG   Selaginella moellendorffii: SELMODRAFT_87617Help
Entry
SELMODRAFT_87617  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
smo  Selaginella moellendorffii
Pathway
smo00410  beta-Alanine metabolism
smo00640  Propanoate metabolism
smo01100  Metabolic pathways
smo04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SELMODRAFT_87617
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SELMODRAFT_87617
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    SELMODRAFT_87617
Enzymes [BR:smo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     SELMODRAFT_87617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCD MCD_N
Motif
Other DBs
NCBI-GeneID: 9636120
NCBI-ProteinID: XP_002966810
JGI: 87617
UniProt: D8R6V5
Position
Unknown
AA seq 431 aa AA seqDB search
YERLDWDNRQRALKILSTEFGVDKKRVKDLIQHYLSLHDDEKSKAGDGENPLEAAQFRTQ
RDLRASLMPLSVRLFEQMNGQAGGLKFLVDLRADLLSALRDDNLPALRALDLELRALFST
WLSPACLELHQVTWNDAASLLEKIVRYEAVHPISNLYDLKRRLGIGRRCFGYFHPAMPGE
PLVFIEVALTDTISNSIQGVLFDKPPISEEDATHAIFYAISSTQAGLSGIDLGNFLIKRV
LRLLQQDMPQIKTFSTLSPIPFFLKWLLPKLASFCFEGNEQRAFKEKLLLAHEEKALKDA
CGDDDTSGESIMYRILGASDPQWGESEQLSAVLKVPLMRLCARYLLLEKKRGKALDPVAN
FHLRNGASMERLNWMGNKSKKGLKESAGMMVNYLYRVESIEENNQAYITRGIIRASPKVE
ELVAGGQQSAL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
tatgaacgcttggattgggataatcggcaaagggccctcaagatactctccacggaattc
ggagttgacaagaaacgagtgaaggatctcatccagcattatcttagcttgcacgatgat
gagaaaagcaaagctggtgacggagaaaatcctctcgaagcagcccagtttcgaacacag
cgggatctgagagcttccttgatgccactatcggtgagattgtttgagcagatgaatggc
caagccggtggcttgaagtttttggtggacctacgtgctgatctgctttctgctctacgt
gatgacaaccttccagcgctgagagctctcgatctcgagttgcgagcgctattttcaacg
tggttaagtcctgcgtgtctggaacttcaccaggttacttggaatgacgcagcttcattg
cttgaaaagattgtccgatatgaggctgtgcatcctatcagtaatttgtacgatcttaag
cgacgattaggcattggtcgtcggtgttttggttatttccatcctgctatgccaggggaa
ccgcttgtgttcatagaagtcgccctcacggacaccattagtaattccattcagggagta
ttgtttgacaagccacctatttccgaagaagatgcgacacatgcgatcttttatgctatt
tcctcgactcaggcaggcttgtcaggtatagatttgggaaacttccttatcaaacgggtg
ctccgcttactgcagcaagatatgcctcaaattaagactttctcaactttaagcccaata
ccgttctttctgaaatggctgcttcctaaactcgcgtcgttctgtttcgaaggaaatgag
cagagggccttcaaagagaagttgcttttggctcacgaagaaaaagctttgaaagacgcc
tgcggagacgatgatacgagcggcgagtcaataatgtatagaattttgggagcatcggat
cctcagtggggcgagtccgaacaactatcagcagttcttaaggtgcctctcatgagatta
tgtgcaagatatcttctacttgaaaagaaacgtggaaaggcattggatccggtagcaaac
ttccatctacgcaatggggctagtatggaacgtttgaactggatgggcaataaatccaag
aaagggctcaaagagagtgcagggatgatggttaactatctttacagggtagaaagcatc
gaagaaaacaatcaagcatacattaccagaggtatcattagagcgtctccaaaagtggaa
gagcttgtagctggagggcagcagtctgcactgtga

DBGET integrated database retrieval system