KEGG   Selaginella moellendorffii: SELMODRAFT_87617Help
Entry
SELMODRAFT_87617  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
smo  Selaginella moellendorffii
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SELMODRAFT_87617
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SELMODRAFT_87617
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    SELMODRAFT_87617
Enzymes [BR:smo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     SELMODRAFT_87617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 431 aa AA seqDB search
YERLDWDNRQRALKILSTEFGVDKKRVKDLIQHYLSLHDDEKSKAGDGENPLEAAQFRTQ
RDLRASLMPLSVRLFEQMNGQAGGLKFLVDLRADLLSALRDDNLPALRALDLELRALFST
WLSPACLELHQVTWNDAASLLEKIVRYEAVHPISNLYDLKRRLGIGRRCFGYFHPAMPGE
PLVFIEVALTDTISNSIQGVLFDKPPISEEDATHAIFYAISSTQAGLSGIDLGNFLIKRV
LRLLQQDMPQIKTFSTLSPIPFFLKWLLPKLASFCFEGNEQRAFKEKLLLAHEEKALKDA
CGDDDTSGESIMYRILGASDPQWGESEQLSAVLKVPLMRLCARYLLLEKKRGKALDPVAN
FHLRNGASMERLNWMGNKSKKGLKESAGMMVNYLYRVESIEENNQAYITRGIIRASPKVE
ELVAGGQQSAL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
tatgaacgcttggattgggataatcggcaaagggccctcaagatactctccacggaattc
ggagttgacaagaaacgagtgaaggatctcatccagcattatcttagcttgcacgatgat
gagaaaagcaaagctggtgacggagaaaatcctctcgaagcagcccagtttcgaacacag
cgggatctgagagcttccttgatgccactatcggtgagattgtttgagcagatgaatggc
caagccggtggcttgaagtttttggtggacctacgtgctgatctgctttctgctctacgt
gatgacaaccttccagcgctgagagctctcgatctcgagttgcgagcgctattttcaacg
tggttaagtcctgcgtgtctggaacttcaccaggttacttggaatgacgcagcttcattg
cttgaaaagattgtccgatatgaggctgtgcatcctatcagtaatttgtacgatcttaag
cgacgattaggcattggtcgtcggtgttttggttatttccatcctgctatgccaggggaa
ccgcttgtgttcatagaagtcgccctcacggacaccattagtaattccattcagggagta
ttgtttgacaagccacctatttccgaagaagatgcgacacatgcgatcttttatgctatt
tcctcgactcaggcaggcttgtcaggtatagatttgggaaacttccttatcaaacgggtg
ctccgcttactgcagcaagatatgcctcaaattaagactttctcaactttaagcccaata
ccgttctttctgaaatggctgcttcctaaactcgcgtcgttctgtttcgaaggaaatgag
cagagggccttcaaagagaagttgcttttggctcacgaagaaaaagctttgaaagacgcc
tgcggagacgatgatacgagcggcgagtcaataatgtatagaattttgggagcatcggat
cctcagtggggcgagtccgaacaactatcagcagttcttaaggtgcctctcatgagatta
tgtgcaagatatcttctacttgaaaagaaacgtggaaaggcattggatccggtagcaaac
ttccatctacgcaatggggctagtatggaacgtttgaactggatgggcaataaatccaag
aaagggctcaaagagagtgcagggatgatggttaactatctttacagggtagaaagcatc
gaagaaaacaatcaagcatacattaccagaggtatcattagagcgtctccaaaagtggaa
gagcttgtagctggagggcagcagtctgcactgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system