KEGG   Selaginella moellendorffii: SELMODRAFT_91640Help
Entry
SELMODRAFT_91640  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
smo  Selaginella moellendorffii
Pathway
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SELMODRAFT_91640
   01210 2-Oxocarboxylic acid metabolism
    SELMODRAFT_91640
   01230 Biosynthesis of amino acids
    SELMODRAFT_91640
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SELMODRAFT_91640
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SELMODRAFT_91640
Enzymes [BR:smo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SELMODRAFT_91640
Amino acid related enzymes [BR:smo01007]
 Aminotransferase (transaminase)
  Class I
   SELMODRAFT_91640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 503 aa AA seqDB search
MTWLSPLTIGNVNPKVKSIVDACSLIEFSLVQVMKCEYAVRGEIVMRAQLLEQELITKPS
SLPFEEIIYCNIGNPQSLGQVPITFFREASVVALCDNPSLLDKAETHALFSADAIARAWK
IIDKIPGKATGAYSHSQGLQYCREEIAAAIARRDGYPAKAEDLYLTDGASVAVHMMMQLL
ISSEKDGIMCPIPQYPLYSASMTLHGGSLVPYYLNESAGWGLEVQELQQQIQKARGSGIN
VRALVVINPGNPTGQVLSEENQKKIIQFCKDERLLLLADEVYQENIYAEGKKFQSFKKVA
RSMGLGENDLSIVSFHSVSKGYYGECGRRGGYMEVTGVDKDVKEQIYKIASVNLCSNISG
QILMSLVSNPPKAGDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSCNQAEGAMYL
FPRLHLPERALKAAAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWHIRCTILPAE
EKMPALITRLTSFHQRFMDEFRD
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacgtggttgtcgccgctcaccatagggaatgtcaatcccaaggtaaaatctatcgtc
gatgcttgtagcttgattgaattctctcttgtccaggtgatgaaatgtgagtatgctgtc
cgaggagagattgtaatgcgagcacagctcctggaacaggaactaatcacgaaaccatcg
tcgctaccattcgaggagattatctactgcaatattgggaatccacagtctctaggccaa
gtaccaatcactttttttcgagaggcaagtgtggttgctttgtgtgacaacccttcgcta
ctcgataaagctgaaactcatgctcttttcagtgctgatgctatagcaagagcctggaag
atcatagataaaattcctggaaaggctactggtgcttatagccacagccagggtctacaa
tattgccgtgaagaaattgcagcagccattgcacgtcgtgatggatatccggccaaagcg
gaggatttataccttacagatggagcgagtgttgcagtgcatatgatgatgcagctactt
ataagctcggaaaaggacgggatcatgtgtcctataccgcaatatcccttgtactcggca
tccatgacactccatggaggaagcttggttccttactatttgaatgagagcgcaggttgg
ggtcttgaagtgcaggaacttcaacagcaaatccagaaagccaggggttctgggatcaat
gttcgagctcttgtagtcatcaatcctgggaatccgactggtcaggtcctgtcggaagaa
aaccagaaaaaaattattcagttttgcaaggacgagcggcttttgttacttgctgatgag
gtgtatcaagagaacatctatgctgaaggtaaaaagttccaatcattcaagaaagttgcg
cgaagtatgggactaggagaaaacgatctcagcatagtatccttccattcggtttcaaaa
ggttattacggtgaatgcggaagaagagggggctacatggaagttacgggagtggacaaa
gacgtcaaggaacaaatctacaagatcgcgtctgtgaatctttgctcaaacatttccggt
caaattctaatgagcctggtttcgaatcctccaaaggccggcgacgaatcttatgaagac
tacgtccgagagcgtgatggcatattggcttcacttgcgagacgcgccaagctgctggcc
gaaggatttaataagctagaaggcgtcagttgcaaccaggccgagggcgcgatgtacttg
tttcctcggctccatttaccggagagagctctcaaggctgcagcagcggtctccatggct
gctgatacgttttacgctcggagattactcgatgcaactggcattgtcgtcgttcctggc
tcaggattcggtcaagttcccggaacttggcacatcagatgcactattcttccggccgag
gaaaagatgccagccttgatcactcgcttgacgagcttccaccaaaggtttatggacgag
tttcgagactga

DBGET integrated database retrieval system