KEGG   Selaginella moellendorffii: SELMODRAFT_92385Help
Entry
SELMODRAFT_92385  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
smo  Selaginella moellendorffii
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smo00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:smo00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 983 aa AA seqDB search
SMFHGRRHSWPLYDYVPKSTLQLLENDPGAPPAHAWRRKLNCHANFLTEFRVTFTEALKL
VLGLGLRLWKFIQAERSQGRTPPIDPFKRGTKPSACHGVPLGGMGGGSIGRGFRGEFRRW
QLLPSVTSEAAVLANQFSVFVTRDKDHGEKKKIASVLSPRPSELDVGKKAQSPEICAWDW
NLDGQNSTYHGLFPRAWTIYDGEPDPDLKISCRQVSPFIPHDYRESSLPVCVFSYVIVNT
GKESASVSLLFTWANSVGGDSHLSGGHSNKPFLEDDGVAGVVLHHRTAKGQPSVEFAIAA
RQNADVAVSVCPSFLVSGKGSTMTAKEMWNQMREKGCFDTDTVCEPSLPSLVNSSLGAAV
SASVTIAPHGKKVIDFALSWDIPEVKFPKGRSYHRRYTQFYGSYGDAAPRLVHDALLNYP
KWEAEIEKWQEPVLKDANLPEWYRFTLFNELYYLVAGGTVWTAFVTPSFRSNGFTSRTNS
ESSITGAVEELVEMIPLNGGTTGNGGVDAILSETEEEIAEKLVKAMEAAILDKQINSAPR
DFPYGTYLLEDGEENVGQFLYLESVEYVMWCTYDVHFYASFALISLFPKLELSIQRDYAA
ATLSHNPELVKFLAGGKWGIKKVLGAVPHDLGIHDPWVEVNAYNIHDTSRWKDLNSKFVL
QIYRDVVATEDLNFARVTWPAVYTAMAYMDRFDRDRDGMIENDGFPDQTYDTWTVHGISA
YCGGLWLAALQAAAAMAEKVNEPNAANYFLRKFRDARKVYDKKLWNGSYFNYDSGSSSNS
NSIQADQMAGQWYAWASGLPPLFDDYKARSALQRIYDYNVMKVKGGKLGAVNGMHPNGRV
DETAMQSREIWSGVTYAAAAAMIHEGMLEQAFTTAEGIYNAGWSDSGYGYWFQTPEAWTT
DGHFRALTYMRPLAIWAMQWALYPPNCVAAGPRIPSKEESAGGSTSSSYLYAGFAKVSEA
LKNAPPQIEQIRSLFHRLCCCCC
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
agcatgtttcacggccgaaggcattcctggccgctctacgactatgtgcccaagtccaca
ctccagctgctggagaacgatccaggggctcctcccgcacacgcatggaggcgtaagctc
aactgtcacgcaaattttctgaccgagttccgggtgacgttcaccgaggcactcaaactg
gtactcgggctggggctgaggttgtggaagttcatacaagccgagcgctctcagggaaga
acacctcccatcgacccgttcaagcgaggaaccaaaccatccgcttgccacggcgtgcca
cttggtggaatgggtggtggaagcattggaagggggtttcgtggcgaattcaggcggtgg
cagctgttgccttctgtcaccagtgaagctgcagtattagcaaatcaattctcagttttc
gtcactcgggacaaggaccatggagaaaagaaaaagatcgcatctgttctttcgcctcgc
ccctcggagcttgatgtcgggaaaaaggctcaaagtccagaaatctgtgcgtgggactgg
aaccttgacggccaaaattcaacttatcatggcttatttccgcgggcgtggactatttat
gatggcgagccagatccggatttgaagatctcatgccgccaagtctcaccgtttattcct
cacgattatcgagaaagcagcttgccagtctgtgtcttctcttacgtgatagtaaacacg
gggaaggaatcggcgagtgttagtctgttatttacctgggcgaattccgttgggggagac
tctcacttatccggtggacattctaacaagccttttctcgaggacgatggagttgcaggt
gttgtccttcaccatcgcaccgcgaaaggacagccaagtgtggagtttgcgattgcggcc
cggcaaaacgccgatgtcgctgtttctgtttgtccgagcttcttggtttcgggaaaagga
agcaccatgacggcgaaggaaatgtggaaccaaatgagagagaaaggatgttttgatacg
gatactgtctgtgagccttctcttccttctctcgtaaattcatcacttggagctgctgtg
tctgcttcagttaccattgcaccgcatggaaagaaggttattgacttcgctctgtcgtgg
gatataccagaagtcaagttcccaaagggcagatcatatcacaggcgctacactcaattt
tatggctcttatggagatgctgctccaagacttgtccacgatgcactcttgaactatcca
aagtgggaggccgaaattgaaaagtggcaggaacctgtgctcaaggacgctaatcttccc
gaatggtatagattcacgctcttcaacgagctttactatttagtcgctggcgggacggtg
tggacagcgtttgtcacaccctcatttcgatcaaacggtttcacgtctagaacaaacagc
gagagcagtatcactggtgctgtggaagagcttgtggagatgatccccctgaacggagga
actaccgggaacggtggcgtcgatgccattctgtcggagacagaagaggagattgcggag
aagctggtgaaagcgatggaggctgctatattggacaagcagatcaattcggcgcctcgc
gatttcccatatggcacgtacttgctcgaggacggggaggagaacgttgggcagttcctc
tacctggagagcgtagagtacgtcatgtggtgcacgtacgatgtgcacttctatgcgtcc
ttcgctctcattagcttgtttcccaagcttgagctgagcatccagcgagattatgcggcc
gcgacactgtctcacaaccctgagctcgtcaagttcctggctgggggcaagtggggtatc
aagaaggtgctaggggcagtgcctcacgacctggggatacacgacccttgggttgaggtg
aacgcgtacaacatccacgacacgagccggtggaaggacctcaactccaagttcgtgctg
cagatatacagggacgtagtggcgacggaggacctcaactttgcgagagtgacatggccg
gccgtgtacactgcaatggcatacatggacagattcgaccgggacagggacggcatgata
gaaaacgatggtttcccagaccagacgtacgatacgtggaccgtgcatggaatcagcgcc
tactgtgggggcctctggctggcggcgttgcaagcagcagcggccatggcggagaaagtg
aacgagcccaacgcggcgaactacttcctcagaaagtttcgtgatgccagaaaagtatac
gacaagaagctgtggaacggttcctacttcaactacgacagcggcagcagcagtaacagc
aactccatccaggccgaccagatggctggccagtggtacgcctgggcgtcgggcttgccc
cccttgtttgacgactacaaggcgcggagtgccctgcagaggatctacgactacaacgtg
atgaaggtaaaaggtggcaagctgggtgctgtaaacgggatgcacccaaacggaagggtg
gacgagaccgcgatgcagtcgcgagagatttggagcggtgtcacgtacgcggctgctgcg
gccatgatacacgaggggatgttggagcaggccttcacgaccgcagagggcatctacaat
gctggctggtcagacagcggctacggctactggttccaaactccggaggcctggactacc
gacggccacttccgggcgctcacctacatgaggccgcttgccatatgggccatgcaatgg
gcactctacccgccaaattgtgtcgccgctgggcctcgcatcccgtccaaggaagaatct
gccggcggttccacttcctcgtcctacctctatgcagggtttgcgaaggtgtcggaagcg
ctcaaaaacgctccaccgcagattgaacagatccgctcgctctttcatcgcctctgctgc
tgctgctgctaa

DBGET integrated database retrieval system