KEGG   Selaginella moellendorffii: SELMODRAFT_92673Help
Entry
SELMODRAFT_92673  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
smo  Selaginella moellendorffii
Pathway
smo00350  Tyrosine metabolism
smo00965  Betalain biosynthesis
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SELMODRAFT_92673
  Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    SELMODRAFT_92673
Enzymes [BR:smo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     SELMODRAFT_92673
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SELMODRAFT_92673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 PCMT CmcI Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 9645530
NCBI-ProteinID: XP_002969775
JGI: 92673
UniProt: D8RFN8
Position
Unknown
AA seq 230 aa AA seqDB search
MGGFFFHGWGGDGREEQLLEYVLENAERGNPQSVIQAVDEFARSGTWFMNVGEEKGRILD
SSIAKKNPQLVLELGTYCGYSAVRMAANLKHPDSKLISLELTPHIADIARRIIDHAGLSS
KVEVLLAPLSRQIDTIKSTLAKTNGQCFDFVFVDHDKDLYLPDYLLLKEKGLIDEGSVIF
ADNMGFPGSPKFWSYIQSHPQELETEVHKSAVEYISWIRDTVTVSTFHKL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggggggatttttcttccatggctggggtggtgatggcagggaggaacagctgctggag
tatgtgctagaaaacgcggaacgaggtaacccccagtcggttatacaggctgtggacgaa
tttgcacgctccggcacctggtttatgaacgttggagaggaaaagggccgcattttggac
tcgtcaatcgccaagaagaatcctcagctcgttctcgagctcggaacttactgtggctac
tcggctgtgagaatggcagcaaatctcaaacaccccgacagcaagctgatctcgctggag
ctcactcctcacatcgctgacatcgctagaaggatcatcgaccacgcagggctttcgtcc
aaagtggaggtgctgctggcgccactgagccgtcagatcgacaccataaagtcgactctg
gccaagacgaacgggcagtgcttcgatttcgtgttcgtggatcacgataaagacttgtac
ttgccggactacttgctgctcaaggagaagggtctcatcgacgaagggagcgtgatcttc
gcggacaacatggggttcccaggctctccaaagttctggagctacatccaatcgcatcct
caggagctggagaccgaggtccacaaatctgccgtggagtacattagttggatccgcgac
acagtgacagtctctacgttccacaagctctaa

DBGET integrated database retrieval system