KEGG   Selaginella moellendorffii: SELMODRAFT_93519Help
Entry
SELMODRAFT_93519  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 368 aa AA seqDB search
MAVRRLAETLSRSLVDDIYKCSNMKQTGVSLKYMMDFGANPTEKSLLLSSQFLHKELPVR
LAHRVMELDNLPYGLSEKAPVLKVRDWYVDSFKDLRTFPEIQDAADEMKFTDLIHQIKIR
HNNVTPTVAMGVQELKEELGRRGGLLELPEIHQFLDRFYMSRIGIRMLIGQHVALHQPNP
APGYIGLISTRVSPVLIAQNAIDDARSACMRTYGSAPEVHVYGDPNFAFAYVPTHLHQML
FELLKNSLRAVQERFMDSDQESPPIRIIVADGVEDVTVKISDEGGGIPRSGLSKIWTYLY
TTAKSPLEESRHMQETPNVMAGYGYGLPISRLYARYFGGDLQVISMEGYGTDAYLHLNRL
GNEQEPLP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcggtccggcgcctcgccgagacgctgtcgaggagcctggtggatgatatctacaag
tgtagcaatatgaagcagacgggcgtgagtctcaagtatatgatggattttggagcgaat
cccaccgagaagagcttgctcctctcctcccagttcttgcacaaggagctccccgtgagg
cttgcgcatcgcgtcatggagctggacaatcttccctatggtctctcagagaaagctccc
gtgctaaaggtgcgtgactggtatgtggactcgttcaaagacttgcggacgtttccggag
atccaagacgctgctgacgagatgaaattcacagacttgatacaccagataaaaattcgc
cacaacaacgtaaccccgactgttgctatgggagttcaagagctcaaggaagagctggga
aggagagggggcttgcttgagctgccggagattcaccagtttcttgaccgcttttatatg
tcgagaattggaattcgtatgctcattggccagcatgttgcgttgcatcagccaaaccca
gcacccggctacattggattgatttccacccgcgtttccccagttttgatcgcgcagaat
gccattgacgacgctcgatcggcctgcatgcgtacgtatggaagtgctccggaagtgcac
gtctatggcgacccaaactttgcattcgcctacgttcccactcatctccatcagatgttg
ttcgagctgctgaaaaactccctccgtgcagtgcaggagcgtttcatggattcggaccaa
gaatctcctcccatcaggatcatcgtcgccgatggtgtcgaagacgtcaccgtgaagata
tctgatgaaggaggtgggattcccaggagcggcctctcaaagatctggacgtacctctac
accaccgcaaagtctccactggaagagagcaggcatatgcaagagacaccgaatgtgatg
gctggctacggctatggcctcccaatcagtcggctgtacgcgaggtactttggaggagat
ttgcaagtcatatcgatggaaggctacggaaccgatgcctatctccatctcaacaggctt
ggcaacgagcaagaaccattgccatga

DBGET integrated database retrieval system