KEGG   Selaginella moellendorffii: SELMODRAFT_94334Help
Entry
SELMODRAFT_94334  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo00260  Glycine, serine and threonine metabolism
smo00750  Vitamin B6 metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01230  Biosynthesis of amino acids
Module
smo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SELMODRAFT_94334
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SELMODRAFT_94334
Enzymes [BR:smo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SELMODRAFT_94334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP OKR_DC_1_N DUF2673
Motif
Other DBs
NCBI-GeneID: 9633219
NCBI-ProteinID: XP_002970959
JGI: 94334
UniProt: D8RIN9
Position
Unknown
AA seq 510 aa AA seqDB search
MGRRISVRAASGSASSGENGVSQVTLESISAEAPPGARKEAVKKRSAENIRDEARRHGIG
APPNTFSAKYVPFSSRSSSSEEYYSLDEVIYRSKTGDLLDVQHDMEALAKHDAKYWKNLF
DSRVGKTSWPYGSGVWSKKEWVLPEIDNDDIVSLFEGNSNLFWAERLGKEMLDMNDLWVK
HCGISHTGSFKDLGMTVLVSQVNRLRKMKKPVVGVGCASTGDTSAALSAYCAAAGIPAIV
FLPANRISIAQLVQPIANGALVLSLDTDFDGCMRLIREVTAELPIYLANSLNSLRLEGQK
TAAIEILQQFDWEVPDWVIVPGGNLGNIYAFFKGFQMCKELGLVDRIPRLVCAQAANANP
LYRFYKSGWEDYKAIKANPTFASAIQIGDPVSIDRAVYAMQQSNGIVEEASEEELMDAAA
QADLTGMFTCPHTGVALSALTKLRRSGVIGATDRTVVVSTAHGLKFTQSKIAYHSKEIPD
LACQFANPPLQVPNDFGAVMDVLRKELSLR
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggggaggagaatcagcgtgagagcagccagtggatcggcgagttctggtgagaatggg
gtttcccaggtgaccctggagtccatctccgccgaggcaccgcccggggcgcgcaaggag
gccgtgaagaagcgatcggcggagaacatcagggacgaggcgaggaggcacggcattggc
gctcctccaaacactttctcggccaagtacgtccccttctcctctcgatccagctcgagc
gaggagtactactccctggacgaggtgatctaccgaagcaagaccggggatctcctcgac
gtccagcacgacatggaagctcttgccaagcacgacgcgaagtactggaagaatctcttc
gactcccgcgtggggaagacttcctggccgtatggttccggtgtgtggagcaagaaggaa
tgggttcttccggagatcgacaatgacgatatagtgagcttgttcgaagggaactcgaat
ctcttctgggcggagaggctgggaaaagagatgctggacatgaacgatctctgggtgaag
cactgtgggatcagccacactggatcgttcaaggacttgggaatgacggtgctggtgagc
caagttaacaggctgagaaagatgaagaagccagtcgtgggtgtcggctgtgcttctacc
ggtgatacgtccgcggctctctcggcctactgcgctgccgcggggattccagccattgtt
ttcctccctgccaaccggatctccatcgcgcagctcgtccagccgatcgcaaacggagct
ctggtgctcagcctggacacggacttcgacggctgcatgaggctgatacgcgaggtgacg
gccgagctcccgatctatcttgcaaactctctcaacagcttgcggctcgaggggcagaag
actgccgcgatcgagatactccagcagttcgactgggaagttcccgactgggtgatagtt
cccggagggaacttgggcaacatctacgcgtttttcaaaggcttccagatgtgcaaggag
ctcgggctcgtcgacaggatcccacgcctcgtgtgcgcacaggcggccaacgcaaacccg
ctctaccgcttctacaagtcgggctgggaggactacaaggcgatcaaggcaaacccgacg
tttgcctcggccatccagattggcgacccggtgtcgatcgacagggccgtgtacgcgatg
cagcagtccaatggtatcgtggaggaggcctcggaggaggagctcatggacgctgctgct
caggcggatctcacagggatgtttacgtgcccccacactggagtagcgctctcggcactg
acaaagctccgtcgcagcggcgtgattggagccacggacaggacggtggtggtgagcacg
gctcacggtctcaagttcacgcagtccaagatcgcgtaccactcgaaagagattccggac
ttggcgtgccagtttgcgaatccgccgctgcaagttcccaatgactttggtgcggtgatg
gatgttcttcgcaaagagttgtcactgaggtaa

DBGET integrated database retrieval system