KEGG   Selaginella moellendorffii: SELMODRAFT_94540Help
Entry
SELMODRAFT_94540  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 324 aa AA seqDB search
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLEALSLLRPVYGLIFLFKWRPGEKDT
RPTVKDNKSIFFASQVINNACATQAILSILMNRVEIDIGPELSMMREFAKDFPPELKGLT
INNSEAIRTAHNSFARPEPFVPDEQKFADKDDDVYHFISYLPVDGVLYELDGLKEGPISL
GECGSGDADSMEWLKMVQPVIQERIEKYSKSEIRFNLMAVIKNRKDLYNQQLAELDRRKN
EISGDDGMDVDSKSGSGNEELAQIDAEIARLTEKITQEDEKFKKWKTENIRRKHNYIPFL
FNFLKILAEKKQLKPLIEKARQKT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtgcacgattgaatccgacccaggcgttttcacggagctcatccagcaaatg
caagtcaagggcgtccaggtggaggagctctacagcttggatttggaagcgctctcgttg
ctccggcctgtctatggactaatctttctcttcaaatggaggcctggagagaaagatact
cggcccactgtgaaggacaacaaatcgatttttttcgcgagccaggttataaacaacgct
tgcgctactcaagcaatactttcgatcctgatgaacagagtggagatcgacattggtccc
gagctttcgatgatgcgagagttcgccaaggatttccctccggagctcaagggcctgacc
atcaacaacagcgaggccattcgcactgctcacaacagctttgcgaggccggagcctttt
gttcccgacgagcaaaagtttgcggacaaagacgacgacgtctatcacttcatcagctat
ctcccggtggacggtgttttgtacgagctggacggactcaaggaagggccgatcagtctg
ggcgagtgtggcagtggagacgctgatagcatggagtggctcaagatggtccagccagtg
atccaagagaggatcgagaagtactccaagagcgagatccgcttcaacctcatggccgtg
atcaagaacaggaaggatctctacaaccagcagctggcggagctcgacaggcggaaaaac
gagataagtggcgacgacggcatggacgtcgactccaagagcggcagcggcaacgaggag
ctggcacagatcgacgcggagatcgctcgactgaccgagaagatcactcaagaggatgaa
aagttcaagaagtggaagactgagaacatccggaggaagcacaactacatccccttcctc
ttcaacttcctcaagatcctggcagagaagaagcagctcaagccgctgattgaaaaggcc
aggcagaagacatag

DBGET integrated database retrieval system