KEGG   Selaginella moellendorffii: SELMODRAFT_95093Help
Entry
SELMODRAFT_95093  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 245 aa AA seqDB search
MADEAPVAKRWLPLEANPDIMNQFCHSLGLSEAAAFYDVYGFDDDLLAMVPAPVLAVLFL
YPINAESEAASKSQEEKLRREGQNESVYFMKQTVGNACGTIGLLHAIGNNTSQIQHGNTK
IFPAEGSYFKRFFESTSKLSPSERASYLENDRELEGAHCVAAAAGDTAPPAIDTPVNLHF
ICFVCVDGGLYELDGRKEQPVYHGPSSPSSVLKDSVKVIQNFISMNPGSLDFNVISLSKT
ENPET
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaagctcccgtggccaagcgatggctgccgctcgaggccaatcccgacatc
atgaatcagttttgccacagccttggattgagcgaagctgctgctttctacgatgtctat
ggctttgatgacgatctgctggctatggttccggcgcctgtgctcgccgtgctctttctt
tacccgatcaatgccgagtcggaagctgcgagtaaatcccaggaagaaaaacttcgtcga
gagggacagaacgagagcgtttatttcatgaaacagacagtcgggaatgcttgtggcacc
atcggtctgctacatgcgattggaaacaacacttctcaaattcagcacggcaatactaaa
atctttccagcagaggggtcgtacttcaaacgtttttttgagtcgaccagcaagttatct
ccttctgaaagagcgagctatctcgaaaacgatagggaactcgagggtgctcactgcgtc
gcagcagctgccggagacactgcgcctccagcgattgacactccagtgaacctgcatttc
atttgctttgtctgcgtggatggtggtctctacgagctagatggccgtaaagaacaacca
gtctaccatggcccttcctctccatcatcagtgctcaaggattccgtgaaagtcatccaa
aacttcatctccatgaaccccggatcgctagacttcaacgtcatttctctctccaagacc
gagaatccggaaacttag

DBGET integrated database retrieval system