KEGG   Selaginella moellendorffii: SELMODRAFT_96899Help
Entry
SELMODRAFT_96899  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 557 aa AA seqDB search
MAVERRKSTPGRGGVVQQRLSEDEARVRAIAEIVGAMVEGCRNGEDVDLNALKSAACRRY
GLARAPKLVEMIAALPENERDLVLPRLKAKPVRTASGIAVVAVMSKPHRCPHIATTGNIC
VYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYIQARGRVDQLRRLGHSVDKVEYIL
MGGTFMSLPADYRDYFIRNLHDALSGHTSRDVEEAVRYSEHAAIKCIGLTIETRPDYCLS
PHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVGAVADCFCLAKDAGFKVVAHMMPNL
PNVDMERDMESFREFFENPSFRADGLKIYPTLVIRGTGLYELWKTGRYKNYPPEQLVNLV
ARVLSLVPPWTRVYRIQRDIPMPLVTSGVEKGNLRELALMRMEDLGLKCRDVRTREAGIQ
DIHNQIKPEEVELVRRDYCANKGWETFLAYEDTRQDILVGLLRLRKCGPNATCPELLGRC
SIVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARKEHRSVKLAVISGVGTRHY
YRKLGYELEGPYMTKRL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggagcgcaggaaatcgacaccgggacggggaggcgtcgtccagcagcggctg
agcgaggacgaggccagggtacgcgcaattgcggagattgtaggggctatggtggaagga
tgccgcaacggtgaggacgtcgatctcaatgcgctcaaatccgctgcttgccgccgctac
ggccttgcccgagcgccaaagctcgtggagatgatcgcggcgttgccagagaatgagcgc
gatctcgtcctgcccaggctcaaggccaagcctgtgcgcactgcctctgggattgccgtg
gttgcggtcatgtccaagcctcatcggtgcccacacatcgccacgactgggaatatctgt
gtctactgcccgggaggcccagattcggacttcgaatatagcacacagtcctacactggg
tatgaaccaacgagcatgcgagcaattcgagcaaggtacaatccttatatacaggctcga
ggtcgagtggatcaactcaggcgtctgggccatagcgtggataaggttgaatatatcctt
atgggaggtactttcatgtctttgccagcagactaccgcgactattttatccgaaatctc
catgacgctctgtctggtcacacctctcgagatgtggaggaagccgtgagatactcagag
catgctgccatcaagtgcattggactgaccattgagacgcgtcccgactactgtctgtct
cctcacttgcgccagatgttgtcttatggctgtacgcggcttgagattggggtgcagagc
acgtacgaagatgtcgctcgagatactaaccggggccatacggttggtgctgttgctgac
tgcttttgccttgccaaggacgctggctttaaggtggttgctcatatgatgcctaacctt
ccaaacgtcgatatggaacgggacatggaaagcttccgcgagttttttgaaaatccttcc
tttcgagcggacggcctcaaaatctatccaacgctggttattcgagggacaggtttgtac
gagctatggaagactggaaggtacaagaactatccacctgaacaactcgtcaatctggtt
gcccgagtgttgtctctggtacctccctggactcgggtctatcgcatacaacgtgacatc
cccatgcctcttgtaacgtcgggcgtcgagaagggaaacctgcgagagctggcgttgatg
aggatggaggacttgggcttgaaatgtagagatgtcaggacaagagaagctgggattcag
gatatacacaatcaaatcaagcctgaagaagtagagctagtaaggcgtgactactgtgct
aacaaaggctgggagacgtttctggcctatgaagacactagacaggatatactggtgggt
ttactgcgcctgagaaaatgcggtcccaacgctacatgccccgagctgctgggacgatgt
tcgatagttcgcgagctgcacgtttatggaactgcggtgcctgttcacggccgtgacgcc
gacaagctacaacaccagggttatggaactcttttgatggaagaagccgagaggatagct
cgcaaggagcatcgatccgtgaaactggcagtgatatccggagtgggaactagacactac
tacaggaaactaggctatgagctagaaggtccctacatgacgaaaagattgtaa

DBGET integrated database retrieval system