KEGG   Selaginella moellendorffii: SELMODRAFT_96933Help
Entry
SELMODRAFT_96933  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
smo  Selaginella moellendorffii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smo01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:smo00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 427 aa AA seqDB search
LRTYKLSELSDSDMKGLAARPRIDFSSILKTVEPIVEDVRFSGDEAVIKYTKKFDGVELD
NIVERVSDLPDPKLDPDVQAAFDVAFDNIYKFHLAQRKTQQLEVETMPGVKCRRVARSID
AVGLYVPGGTAVLPSTALMLAVPAGIAGCETIVLATPPRSDGSICPEVLYCAKKAGATHI
LKAGGAQAVAAMAWGTNSCPKVDKILGPGNQYVTAAKMLLQNSESMISIDMPAGPSEVLV
IADRNANAIHVAADLLSQAEHGPDSQVVLVAVGSVDLEAIEQQVYKQCQELPRGDIASVA
LGHSFIVVAPGMAEACKFSNVYAPEHLIVNAEDAEAWLDHIKNAGSVFLGRWTPESVGDY
ASGTNHVLPTYGYARMYGGVSLDSFVKYMTVQSLSREGLGLIGPSVAMMAEVEGLDAHKR
AVTLRLA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcacttacaagctatccgagctgagcgacagcgatatgaaaggcctggcagcgcgt
cccaggattgatttctcctccattttaaaaacagtggaaccaattgtcgaagatgtgagg
ttttctggcgatgaagcggtgatcaagtacaccaagaaattcgatggagtggagcttgac
aacattgtcgaaagggtgtccgaccttccagatccaaagctcgatccagatgtccaagct
gcatttgatgtggcctttgacaacatctacaaattccatcttgcacagcgaaagactcaa
cagcttgaagtagaaaccatgcccggagttaaatgccggcgagttgcgaggagtatcgac
gccgtcgggctttacgtccctggtggaacggctgttcttccatcaacagcgctcatgcta
gcagtgcccgcaggtattgccggatgtgagacgattgttcttgcgactccaccacggtcg
gacggttcaatatgtccggaagttttatattgtgctaagaaagctggagctactcacatc
ctaaaagctggaggagcacaggctgtagctgccatggcatggggcactaattcctgtcca
aaagtcgacaagatcctaggccctggaaatcagtatgtaactgctgcgaagatgttgcta
cagaatagcgagtctatgatctccatagatatgcctgctgggccctcggaagtccttgtc
atcgcggatagaaacgcgaatgcgatccatgtagccgcggatctcttatcccaggcggag
cacggcccggacagccaagtggttctcgtggctgtcggcagcgtcgacttagaggccatc
gaacagcaagtttacaagcagtgccaggagcttccccggggagatatcgcgtcggtcgcg
ctgggtcacagcttcatcgtcgttgctccaggcatggcagaggcttgcaagttctccaat
gtctacgcgccggagcatctcattgtcaacgccgaggacgctgaggcttggctggatcac
ataaaaaacgcagggtctgtgttcttgggaaggtggacgcccgagagcgttggcgactac
gcgagtggaacaaaccacgtcctcccgacgtacggctacgctaggatgtacggcggcgtg
tcgctggactcgttcgtcaagtacatgaccgtgcaatcgctgagccgcgaagggcttggt
ttgatcggcccgtccgtggcgatgatggccgaggtcgaaggcctggacgcccacaagcgc
gctgtgaccctgcgcttggcgtga

DBGET integrated database retrieval system