KEGG   Sordaria macrospora: SMAC_00123Help
Entry
SMAC_00123        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K11155  
diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
smp  Sordaria macrospora
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SMAC_00123
Enzymes [BR:smp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     SMAC_00123
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     SMAC_00123
    2.3.1.76  retinol O-fatty-acyltransferase
     SMAC_00123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 520 aa AA seqDB search
MSSPTTTATGLDPAVQNDNVIRRTHGPENSKISNGEANGSVDSDNDTRKQMKKAIRSKYR
HVEAVHSQSRPSCLSHDTTESPSFLGFRNLMYGVLICIGCHDFRKSDINMGLLLYFLIPC
HLFIAYIIEYYAAVQARAERNAASEAKKGEGNHQDGTSSPTEEQHRKFQSTWKLVRLLHA
INVTTALALTSYVVYYHIHHPLIGTLTEVHAIVVWLKTASYAFTNRDLRHAYLHPARGEL
DALPELYAQCPYPENITMGNLCYFWWAPTLVYQPVYPRTNKIRWSFVAKRCGEVVCLSVF
IWFTSAQYATPVLRNSLDKIASLDIPSIVERLLKLSTISLIIWLAGFFALFQSFLNALAE
VMRFADRSFYDEWWNSESLGVYWRTWNKPVYQYFKRHVYSPMRSRGWSNGTASLAVFFLS
AVLHELLVGVPTHNIIGVAFLGMFLQLPLIQLTKPLEKKTSPNGKLLGNTIFWVSFTIFG
QPFAALMYFYAWQAKYGSVSKMATMQQLVEQGQGTCPPLG
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtccaacgacgacggcaacggggcttgaccccgctgtccagaacgacaacgtc
atccgtcggactcatggtccagaaaacagcaaaatttctaatggcgaggccaatggctcc
gttgacagcgataacgacaccagaaaacaaatgaagaaggcaattcggagtaaatatcgt
catgtcgaggccgttcactctcagtcaagaccatcctgcctgagccatgacacgaccgag
agccccagcttcctcgggttccgcaacctgatgtacggcgtccttatctgcatcggctgc
catgacttccgcaaatccgacatcaacatggggctgctcctctacttcctgatcccctgc
cacctcttcatcgcctacatcatcgagtactacgccgccgtccaggcccgtgctgagcgt
aatgcagccagcgaggccaagaaaggggaggggaaccaccaagacggcaccagcagcccg
actgaagaacagcaccgcaagttccagtccacctggaaactcgtccgcctcctccacgcc
atcaacgtgaccaccgccctcgccctcacctcgtacgtggtctactaccatatccaccac
cctttaatcggcaccctgacggaggtgcacgccatcgtggtctggctcaagacggcctcg
tacgcattcaccaaccgcgacctgcgccacgcctacctgcacccggcccgcggcgagctc
gacgccttaccagaactgtacgcgcagtgcccttacccggaaaacatcaccatgggcaac
ctctgttacttttggtgggccccgacactggtctaccagcccgtctatccacgcaccaac
aagatccgctggagcttcgtggccaagcgatgtggcgaggtagtttgcctgagcgtgttc
atctggttcacttcggcgcaatacgctactcctgtgctgcgcaactcgctggataagatc
gcttcgctcgatatcccgagcattgtcgagcgcctgctaaagctgagcaccatttccttg
atcatctggctggcgggcttctttgcgttattccagagcttcctgaacgcgctggcggag
gtgatgaggtttgcggaccggtcgttctacgatgagtggtggaacagcgagagcttgggc
gtgtactggcgcacgtggaacaagccggtctatcagtacttcaagcgccatgtgtactca
ccgatgcggtcgagggggtggagcaatgggacggcaagtttggccgtgttctttttgagt
gccgtgttgcatgagttgttggttggtgtgcctactcataacattattggcgtcgctttc
ctcggcatgttcctccagttgccgctcatccagctcaccaagcccttggagaagaagacg
tctccaaacggcaagctgctgggcaacaccatcttctgggtctcctttaccatctttggt
caaccttttgccgccctcatgtacttttacgcgtggcaggccaagtatgggagcgtaagc
aagatggctactatgcaacagcttgtcgaacaggggcaggggacttgccctcctcttggt
tag

DBGET integrated database retrieval system