KEGG   Sordaria macrospora: SMAC_00123Help
Entry
SMAC_00123        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K11155  
diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
smp  Sordaria macrospora
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smp00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 520 aa AA seqDB search
MSSPTTTATGLDPAVQNDNVIRRTHGPENSKISNGEANGSVDSDNDTRKQMKKAIRSKYR
HVEAVHSQSRPSCLSHDTTESPSFLGFRNLMYGVLICIGCHDFRKSDINMGLLLYFLIPC
HLFIAYIIEYYAAVQARAERNAASEAKKGEGNHQDGTSSPTEEQHRKFQSTWKLVRLLHA
INVTTALALTSYVVYYHIHHPLIGTLTEVHAIVVWLKTASYAFTNRDLRHAYLHPARGEL
DALPELYAQCPYPENITMGNLCYFWWAPTLVYQPVYPRTNKIRWSFVAKRCGEVVCLSVF
IWFTSAQYATPVLRNSLDKIASLDIPSIVERLLKLSTISLIIWLAGFFALFQSFLNALAE
VMRFADRSFYDEWWNSESLGVYWRTWNKPVYQYFKRHVYSPMRSRGWSNGTASLAVFFLS
AVLHELLVGVPTHNIIGVAFLGMFLQLPLIQLTKPLEKKTSPNGKLLGNTIFWVSFTIFG
QPFAALMYFYAWQAKYGSVSKMATMQQLVEQGQGTCPPLG
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtccaacgacgacggcaacggggcttgaccccgctgtccagaacgacaacgtc
atccgtcggactcatggtccagaaaacagcaaaatttctaatggcgaggccaatggctcc
gttgacagcgataacgacaccagaaaacaaatgaagaaggcaattcggagtaaatatcgt
catgtcgaggccgttcactctcagtcaagaccatcctgcctgagccatgacacgaccgag
agccccagcttcctcgggttccgcaacctgatgtacggcgtccttatctgcatcggctgc
catgacttccgcaaatccgacatcaacatggggctgctcctctacttcctgatcccctgc
cacctcttcatcgcctacatcatcgagtactacgccgccgtccaggcccgtgctgagcgt
aatgcagccagcgaggccaagaaaggggaggggaaccaccaagacggcaccagcagcccg
actgaagaacagcaccgcaagttccagtccacctggaaactcgtccgcctcctccacgcc
atcaacgtgaccaccgccctcgccctcacctcgtacgtggtctactaccatatccaccac
cctttaatcggcaccctgacggaggtgcacgccatcgtggtctggctcaagacggcctcg
tacgcattcaccaaccgcgacctgcgccacgcctacctgcacccggcccgcggcgagctc
gacgccttaccagaactgtacgcgcagtgcccttacccggaaaacatcaccatgggcaac
ctctgttacttttggtgggccccgacactggtctaccagcccgtctatccacgcaccaac
aagatccgctggagcttcgtggccaagcgatgtggcgaggtagtttgcctgagcgtgttc
atctggttcacttcggcgcaatacgctactcctgtgctgcgcaactcgctggataagatc
gcttcgctcgatatcccgagcattgtcgagcgcctgctaaagctgagcaccatttccttg
atcatctggctggcgggcttctttgcgttattccagagcttcctgaacgcgctggcggag
gtgatgaggtttgcggaccggtcgttctacgatgagtggtggaacagcgagagcttgggc
gtgtactggcgcacgtggaacaagccggtctatcagtacttcaagcgccatgtgtactca
ccgatgcggtcgagggggtggagcaatgggacggcaagtttggccgtgttctttttgagt
gccgtgttgcatgagttgttggttggtgtgcctactcataacattattggcgtcgctttc
ctcggcatgttcctccagttgccgctcatccagctcaccaagcccttggagaagaagacg
tctccaaacggcaagctgctgggcaacaccatcttctgggtctcctttaccatctttggt
caaccttttgccgccctcatgtacttttacgcgtggcaggccaagtatgggagcgtaagc
aagatggctactatgcaacagcttgtcgaacaggggcaggggacttgccctcctcttggt
tag

DBGET integrated database retrieval system