KEGG   Sordaria macrospora: SMAC_00134Help
Entry
SMAC_00134        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
smp  Sordaria macrospora
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:smp03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:smp04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 323 aa AA seqDB search
MADHTEVDLDSIIDRLLEVRGSRPGKQVQLLEAEIRYLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
NSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKQKYVPSLKGGTSKIMTPRKHK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccataccgaagtcgatctcgactctataatcgaccgcctcttggaggtgcgg
ggcagccggcctggtaagcaggtgcagctgctggaagccgagattcgctatctctgcacc
aaggcccgtgagatcttcatttctcagcccatcctgctcgagctcgaggctcccatcaag
atttgcggcgatatccacggtcaatactatgatctcctccgtctcttcgagtacggtggc
ttccctcccgaggccaactacctcttcctaggtgattacgtcgatcgcggcaagcagtct
ctcgagaccatctgcctgctcctcgcctacaagatcaagtaccccgagaacttcttcatc
cttcgtggcaaccacgaatgcgcgtccatcaaccgtatctatggtttctacgacgagtgc
aagcgcaggtacaacatcaagctttggaagacattcaccgactgcttcaactgcctaccg
atcgctgccattatcgacgagaagattttcacgatgcacggtggcttgagcccggatctc
aactccatggagcagatccgccgagtcatgcgaccaactgacattcctgactgtggtctt
ctttgcgatcttctgtggtccgaccccgataaggatattactggctggagcgaaaacgac
cgtggtgtttccttcacgtttggtccggatgttgtttcgcgcttcctccaaaaacacgat
atggatttgatctgccgtgctcaccaggttgtcgaggacggatacgagttcttctcgaag
cgccaactcgttactttgtttagtgcccccaattactgcggcgagtttgacaacgctggt
gctatgatgagcgtcgatgaaagtttgctctgctctttccagattctcaagcccgcagag
aagaaacagaagtacgttcccagtctcaaaggaggcactagcaaaatcatgacccccagg
aagcacaagtaa

DBGET integrated database retrieval system