KEGG   Sordaria macrospora: SMAC_00145Help
Entry
SMAC_00145        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
smp  Sordaria macrospora
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SMAC_00145
   00670 One carbon pool by folate
    SMAC_00145
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SMAC_00145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 223 aa AA seqDB search
MSAILPSIELTLVLAATRDMGIGLNGGLPWTGLKKEMAYFARVTKRLPSQLTGTKALNAV
IMGRKTWDSIPPKFRPLKGRLNIVISRSVTSAVPSLSEGKLESEEGPVMASSLEQAINYL
RQQQQEQQEQKVGKVFVIGGGQIYGAALELPKEVSKRILLTRVLSPEFECDTFFPLELKE
QQEGSEWVRKSKAELDEFVGEEVPGAVQVENATEYEFQMWERR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccatcctcccctcgatcgagctcacgctcgtcctcgccgccacgcgcgacatg
ggaatcggcctcaacggcggtcttccatggactggtctcaagaaggaaatggcctacttc
gctcgcgtaacgaagagattgcccagtcagctcaccggcaccaaagccctcaacgccgta
atcatgggccgcaaaacctgggactccatcccgcccaagttccgtcccttaaagggtcgt
ctgaacatcgtcatcagccgctctgtcacctctgctgtcccatccctctcagaaggaaag
cttgaaagtgaagaaggaccggtcatggcctcttccctggaacaagctatcaactacctt
cgccagcagcaacaagaacaacaggaacaaaaagtgggaaaggtctttgtcatcggcggc
ggacaaatctacggcgcggcgctggagctgcccaaggaggtgagcaagcggattctgttg
acgagggtgttgagtccggagtttgagtgtgatacgttctttcctttggagttgaaggaa
cagcaggagggatcggaatgggtgaggaagagcaaggcggagttggatgagtttgtgggt
gaggaggttcctggagctgtgcaggttgagaatgcgacggagtatgaatttcagatgtgg
gagaggaggtag

DBGET integrated database retrieval system