KEGG   Sordaria macrospora: SMAC_00145Help
Entry
SMAC_00145        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
smp  Sordaria macrospora
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smp00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:smp00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 223 aa AA seqDB search
MSAILPSIELTLVLAATRDMGIGLNGGLPWTGLKKEMAYFARVTKRLPSQLTGTKALNAV
IMGRKTWDSIPPKFRPLKGRLNIVISRSVTSAVPSLSEGKLESEEGPVMASSLEQAINYL
RQQQQEQQEQKVGKVFVIGGGQIYGAALELPKEVSKRILLTRVLSPEFECDTFFPLELKE
QQEGSEWVRKSKAELDEFVGEEVPGAVQVENATEYEFQMWERR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccatcctcccctcgatcgagctcacgctcgtcctcgccgccacgcgcgacatg
ggaatcggcctcaacggcggtcttccatggactggtctcaagaaggaaatggcctacttc
gctcgcgtaacgaagagattgcccagtcagctcaccggcaccaaagccctcaacgccgta
atcatgggccgcaaaacctgggactccatcccgcccaagttccgtcccttaaagggtcgt
ctgaacatcgtcatcagccgctctgtcacctctgctgtcccatccctctcagaaggaaag
cttgaaagtgaagaaggaccggtcatggcctcttccctggaacaagctatcaactacctt
cgccagcagcaacaagaacaacaggaacaaaaagtgggaaaggtctttgtcatcggcggc
ggacaaatctacggcgcggcgctggagctgcccaaggaggtgagcaagcggattctgttg
acgagggtgttgagtccggagtttgagtgtgatacgttctttcctttggagttgaaggaa
cagcaggagggatcggaatgggtgaggaagagcaaggcggagttggatgagtttgtgggt
gaggaggttcctggagctgtgcaggttgagaatgcgacggagtatgaatttcagatgtgg
gagaggaggtag

DBGET integrated database retrieval system