KEGG   Sordaria macrospora: SMAC_00255Help
Entry
SMAC_00255        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
smp  Sordaria macrospora
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:smp00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SMAC_00255
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SMAC_00255
Protein kinases [BR:smp01001]
 Serine/threonine protein kinases: Other group
  TTK family
   SMAC_00255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 919 aa AA seqDB search
MSSISPTPMGAGSHFTSMGRRTSTRQALRRPPSRPMLNRSESNPQSQSQQYSNVNDSSDD
EIPVPMKLSALTKALLNDGHASEAPSFAQHGAPEDLQLSPPARPPSRITRRSALTSSKSE
ERSEGVRTREARRSIRGGSLQPIERPTSPPQNDSSNNRDGSPAPRKRVVRLSNAVQPVSF
SGNVRRLSSTTAPQRRTRTESREREAEKEIPSFLQQQGDPGSDSAGDAHTPVIRTVRIQV
GSGSSGSKNRLSLGGGGGSSSGSFGAVSGKRGTGFGDHEIPEDPATIGRPLAAAPQSSMR
IKRVAKVPGSFLSGPARRGRRRQSDEDEAAHGENEAMGMNQDHDGNYESHMQSQVEAAMG
EQQSSFYASNNNYRDYAASGSPVGGRAGAVRRRESSFRELDRDNGELGYKVPEPHPDMPM
NNDKENEAPPTFKRAKLTPSIMLDHEIPKPAIPEPMALDIGRDIGRDLKRLSISPDRKAL
AHKSQNTPHRPAPPPPPKMSVVETATAAAGASATTGAAKKRQVLLRVNGRTYTRIDCIGR
GGSGKVYRVSAESGKMLALKRVSLEHADENTVKGFKGEIDLLKRLNGVERVIQLIDHELN
LEKQVLSVLMEVGELDFNTLLKSRQSTAEGARLDPTFIRYYWKEMLECVQAVHVRDVVHS
DLKPANFVLVQGRLKLIDFGIANAIQTEMTVNVHRETQIGTPNYMSPESLMDSNQYAFTS
AQNGKFCIPPPLNHRSLGAPKLMKLGKPSDVWSLGCILYQMVYGLPPFGKIANQMSRCQA
IINWSYQIDFPEATEDGSRVPPSVIRTMRRCLNREQRERPTCDELLADTDPFLYPQEFDP
SVYAAAEHGKVLPVTEELLSRLIQSVVQRCKERMPTEAEVVNTWPQAYWATVRKAVMGAT
GNNAGGGGGSGQGGGGHQR
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatttcgccaacgccaatgggcgctgggagccacttcacgtctatgggaaga
aggacgtccactagacaagctttgcgacgcccgccatcgcgacccatgctcaatcgcagc
gagtcgaacccccagtcgcaatcacaacaatattccaacgtcaacgacagctcagatgac
gagattcccgtacccatgaaactcagcgccttaaccaaggctctgctgaacgatggccat
gcatccgaagccccatcctttgcgcaacatggcgctcctgaggacctacagctatcgccc
ccagctcgaccaccatcacgaattactagaagaagcgcgttgacatcatcgaagtccgag
gaaagatcggaaggtgtgaggacgcgggaagcaaggcggagtatcagaggaggaagtctt
caacccatcgaaaggccgacatcgccaccccagaatgacagcagcaacaatcgcgacggc
agcccagcgcctaggaaacgagtggtccgccttagcaatgccgtgcagcctgttagcttt
tccggaaatgtccgaagactctcatcaacgacggcaccccagaggagaaccaggacggag
agcagggaaagagaggcggagaaagaaatcccatcgtttctacagcagcaaggcgatcca
ggatcagactcagcgggagatgcccacacgccggttatcagaacggtcaggattcaagtt
ggttccgggtcttcaggcagcaagaatcggctttcgcttggtggaggaggaggttcatcg
agtgggtcgtttggtgctgtttctggaaaacgcggcacaggatttggtgatcacgaaata
cccgaggatcctgcaaccattggaaggccactggcggcggcaccacaaagctcaatgcgc
atcaagagagtcgcaaaagttccgggaagctttcttagtggcccagcacgacgagggcgg
agaaggcagagcgatgaggacgaggcagcgcatggagaaaatgaggccatgggcatgaac
caagaccacgatgggaattacgagagccacatgcagagccaggtcgaagccgctatgggc
gagcaacagtcgtcgttctatgcatccaacaataactaccgcgactatgctgcatcagga
agcccggtcggcggtagagctggagcggttcgcaggcgagaatccagcttcagagaattg
gatagagataacggggagctgggctacaaggttcctgagcctcatccagatatgcccatg
aacaacgataaggagaacgaggccccgccaacattcaagagggcgaaactgaccccatcc
ataatgctcgatcacgaaatcccgaaaccagcgatccccgaaccgatggccctcgacatt
gggcgagacatcgggcgagatcttaagaggctgtcgatctcacctgaccgcaaagcattg
gcgcataagagtcagaatacaccacacaggcctgcgcctccacctccaccaaagatgtcg
gttgtcgagactgccacagctgctgctggagcttctgcgacgacgggagccgccaagaag
aggcaggtccttttgcgtgtgaacggccggacatacacccgtattgactgcattggaagg
ggcggctctggcaaagtttaccgtgtctcggctgagagtgggaagatgctggcgttgaag
agggtgtcccttgaacatgccgatgaaaacactgtgaagggattcaaaggtgaaattgat
ctgttgaagcgtttgaacggtgtggaacgggttattcaactcatcgaccatgagctgaat
ctggagaagcaggttctcagtgtgctcatggaagtaggcgaacttgacttcaacacgctc
ctcaaaagccgccagagcaccgcagaaggcgcccgtctcgacccgaccttcattcgttat
tactggaaagagatgcttgaatgcgtgcaagccgtgcacgtccgcgacgtcgtgcacagc
gatctcaagccggccaatttcgtccttgtgcagggccgcctcaagctcatcgacttcggc
atcgccaacgccatccagaccgagatgacggtcaatgtgcaccgcgaaacgcaaatcggc
acgcccaactacatgtcgcccgaatccctgatggactcgaaccagtacgccttcacatcc
gcgcagaacggcaagttctgcatcccgccgccgctgaaccaccgcagcctcggcgcgccc
aagctcatgaagctcggcaagccctcggacgtctggtcgctcggctgcatcttgtatcaa
atggtctacggcctgccgccctttggtaagattgccaaccagatgtcgcgctgccaggcc
atcatcaactggtcgtaccagatcgatttcccggaagccaccgaggacggcagtcgcgtg
ccgccctcggtcatccgcaccatgcgccgctgtctcaaccgcgagcagcgcgagcgcccc
acgtgcgacgagctgctggcggataccgacccgttcctgtacccgcaggagttcgacccg
tcggtgtacgcggccgcagaacatggcaaggtcctgcctgtcacggaggagctgttgtct
aggcttatacagagcgtcgtgcagaggtgcaaggagaggatgccgaccgaggccgaggta
gtaaatacgtggccgcaggcgtactgggctactgtgaggaaggcggtcatgggtgccact
ggcaataatgctggtggtggtggtgggagtgggcaagggggtggcggccatcagaggtag

DBGET integrated database retrieval system