KEGG   Sordaria macrospora: SMAC_00384Help
Entry
SMAC_00384        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
smp  Sordaria macrospora
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SMAC_00384
Enzymes [BR:smp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SMAC_00384
Exosome [BR:smp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SMAC_00384
  Exosomal proteins of colorectal cancer cells
   SMAC_00384
  Exosomal proteins of bladder cancer cells
   SMAC_00384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 505 aa AA seqDB search
MHAPTKFALGLLAAAAVATASDVIQLKKDTFDDFVKTNDIVLAEFFAPWCGHCKALAPEY
EEAATTLKEKNIKLAKIDCTEESELCQQHGVEGYPTLKVFRGLDTVSPYKGQRKAGAITS
YMIKQSLPSVSVLTKDNIEEFKKADKVVIVAYFDATDKAANETFSKVADKLRDEYPFGAS
SDVALAEAEGVTAPAIVLYKDFDEGKAVFTEKFDAEAIEKFAKTASTPLIGEVGPDTYAG
YMSAGIPLAYIFAETPEERKELSEALKPIAESQRGVINFATIDAKAFGAHAGNLNLKTDK
FPAFAIQETTKNQKFPFDQEKEITVESIQKFVDDFVGGKVEPSIKSEPIPETQEGPVTVV
VAKSYNDIVLDDTKDVLIEFYAPWCGHCKALAPKYDELATLYANSEFKDKVVIAKVDATL
NDVPDEIQGFPTIKLYAAGAKDKPVEYSGSRTVEDLIKFISENGKYKAAPSDEAEESVAA
SAESGSSTETGTVEEPAKETSHDEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcccctaccaagttcgccctcgggcttctcgcggccgccgccgtggctactgcc
tccgatgttatccagttgaagaaggacaccttcgacgactttgtcaagaccaacgacatt
gttcttgctgagttcttcgccccttggtgcggtcactgcaaggcccttgcccccgagtac
gaggaggctgccaccaccctcaaggagaagaacatcaagctcgccaagatcgactgcact
gaggagtccgagttgtgccagcagcatggcgttgagggttaccctaccctcaaggtcttc
cgtggcctcgacaccgtctccccctacaagggtcagcgcaaggccggtgccatcacctcc
tacatgatcaagcagtcccttccctctgtctctgtcctcaccaaggacaacattgaggag
ttcaagaaggccgacaaggtcgtcattgtcgcctacttcgatgccaccgacaaggccgcc
aacgagaccttctccaaggtcgccgataagctccgcgacgagtacccctttggtgccagc
agcgatgtcgctctcgccgaggctgagggtgtcaccgcccctgccatcgttctctacaag
gacttcgacgagggcaaggccgtcttcactgagaagttcgacgccgaggccatcgagaag
ttcgccaagaccgcctccacccccctcatcggtgaggttggccctgatacctatgctgga
tacatgtccgctggcattcccctcgcctacatcttcgccgagacccccgaggagcgcaag
gagcttagcgaggccctcaagcccattgctgagtcccagcgtggtgttatcaacttcgct
accattgacgccaaggctttcggtgctcacgccggcaacttgaacctcaagaccgacaag
ttccctgctttcgccatccaggagactaccaagaaccagaagttccccttcgaccaggag
aaggagattaccgtcgagtccatccagaagttcgttgacgacttcgttggcggcaaggtc
gagccttccatcaagtctgagcccatccccgagacccaggagggccccgtcaccgtcgtc
gtcgccaagagctacaacgacattgtccttgacgacaccaaggatgtcctcattgagttc
tacgctccctggtgcggtcactgcaaggctctcgctcccaagtacgatgagcttgctacc
ctctatgccaactccgagttcaaggacaaggttgtcatcgccaaggttgatgctaccctc
aacgacgttcccgatgagatccagggcttccccaccatcaagctttacgctgctggtgcc
aaggacaagcccgttgagtactctggctcccgcaccgttgaggacctgatcaagttcatc
tccgagaacggcaagtacaaggctgctccctcggatgaggccgaggagtccgttgccgct
tccgccgagtctggttcctccaccgagactggcaccgttgaggagcccgccaaggagacc
agccacgacgagctctaa

DBGET integrated database retrieval system