KEGG   Sordaria macrospora: SMAC_00595Help
Entry
SMAC_00595        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
smp  Sordaria macrospora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 221 aa AA seqDB search
MVSIKSLLLGAAGALAVPFNATEFSELNVRAGTPSSTGTHNGFYYSFWTDGGGTVNYANG
NGGSYTVNWSNVGNFVGGKGWNPGSARTITYSGSFNPSGNGYLAVYGWTRNPLVEYYVIE
NFGTYNPSSGATRLGSVTTDGSTYDIYKSTRYNQPSIDGTQTFNQYWSVRQQKRSGGSVT
MSNHFNAWAKAGLQLGTHNYQIVATEGYQSSGSSSITVQGP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggtctccatcaagtccctccttctcggcgccgccggtgccctcgccgtccccttcaac
gccaccgagttctccgagcttaacgtgcgcgccggcactcccagcagcaccggcacccac
aacggcttctactactccttctggactgacggtggcggcaccgtcaactacgccaacggc
aacggcggttcctacacggtgaactggtccaacgtcggcaacttcgtcggcggcaagggc
tggaaccccggttccgctcgcaccatcacctactcgggctccttcaacccctccggcaac
ggctacctcgccgtctacggctggacccgcaacccgcttgtcgagtactatgtcatcgag
aactttggcacatacaacccctcgtcgggcgccacccgcctcggatccgtcactaccgac
ggctccacctacgacatctacaagtctacccgctacaaccagccgtccatcgatggcact
caaaccttcaaccagtactggtcggtccgccagcagaagcgcagcggtggttccgtcacc
atgagcaaccatttcaacgcctgggccaaggctggtctgcagttgggcacccacaactac
cagattgtggctactgagggataccagagcagtggatcttcttccatcactgttcagggc
ccttga

DBGET integrated database retrieval system