KEGG   Sordaria macrospora: SMAC_00733Help
Entry
SMAC_00733        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
smp  Sordaria macrospora
Pathway
smp03022  Basal transcription factors
smp03420  Nucleotide excision repair
Module
smp_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SMAC_00733
  Replication and repair
   03420 Nucleotide excision repair
    SMAC_00733
Transcription machinery [BR:smp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SMAC_00733
DNA repair and recombination proteins [BR:smp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SMAC_00733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2
Motif
Other DBs
NCBI-GeneID: 10807363
NCBI-ProteinID: XP_003349845
UniProt: F7VMX8
Position
Unknown
AA seq 496 aa AA seqDB search
MSLGGQQLLEYLEKLPGTAFRRLYQSPATALAIFRRMLSHHAKVIVRGLLYMPDPFPLTS
LDIWFPPESGGKIHRDRTIAALRSLHVLQVSPPGKDRTQEIQITTSFKKGLQLAFEGGGE
DGSFGVPSSLPVDPTIDIGYLDKYARKKWDDILHYVVNSLGVQSSSEGVSGPKASVKELL
LAGRLVERRPDTRTGIGITQAGFTFLLQESNAQVWTLLLLWLEAADHAADSGMDSIDMLS
FLFMLSSLELGTAYDTSALTETRRNMLPSLVDFGLIYFPRDTRQFFPTRLATTLTSTASA
LRTVSSAFTAATANPSGEPGTTTSTSGGPAGATPADKTGTSKGIIIETNYRIYAYTTSPL
QIAVLALFCQLNMRFPNMVSAALRAIGFGITADQIISYLHAHAHQQMVREATVTGKTVLP
PTVVDQIRLWQLENERMQTTAGFLFKDFESTEEYAALSRYAEEIGVLVWKNDKRQLFFAS
KHEQLRDYLKSRKKGE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcactcggcggacaacagctcctggagtacctggagaagctgcctgggacagctttt
aggaggctataccagtcacccgcaacagctctggctatcttccgccgaatgctgtctcac
catgccaaggttattgtccgaggcctactctacatgccggacccgttccctctaacatcc
ctcgacatatggttccctccagagtccggtgggaagatacaccgcgatcgcaccatagcc
gctctacgatccctccacgtcctacaggtctcaccgccgggtaaggaccggacccaagaa
atccaaatcacaacaagcttcaagaagggcctacaactggccttcgaaggtggcggcgaa
gatggtagctttggtgttcccagttctctgcccgtcgatcccaccatcgatatcggctac
ctcgacaagtacgcccgcaagaagtgggacgacatcctccactatgtcgtcaacagtctc
ggagtccaaagcagttccgaaggggtgagcggtcccaaggccagcgttaaggaactgctc
ctggccggtcgcctcgtcgaacgccgtcccgacacccgaacaggcattggcattacgcaa
gctggtttcacattcctccttcaggagtccaacgcccaagtatggactttgcttctcctc
tggctcgaagcagctgaccacgcggccgactcgggcatggacagcatcgacatgctctct
ttcctcttcatgctatcctcgctcgagctcggcaccgcctacgacacctcagccctaacc
gaaacccggcggaatatgcttccctcgctcgtcgacttcgggctgatctacttcccgcgc
gacacgcggcagttcttccctacccgcctcgccacaaccctaaccagcaccgcctcggcc
ctgcgcaccgtctcctcggccttcaccgccgcgacagctaacccttccggcgaaccaggc
acgacgaccagcaccagcggcggtccggccggcgccacccccgccgataaaaccggcaca
tcaaagggcatcatcatcgagaccaattaccgcatctacgcttacaccacctcgcccctc
caaattgccgtcctggctctcttctgccagcttaacatgcgtttccccaacatggtctcg
gccgccttacgcgctatcggcttcggcatcacagccgaccagatcatttcctacctgcac
gcccatgcccatcagcagatggttagggaagccactgtgacgggcaagacggtgttgccg
ccgacggtggtggaccagatccgactttggcagctggagaatgagcggatgcagacgacg
gcgggattcctgttcaaggactttgagagcacggaggagtatgcggcgctgtcgagatac
gccgaggagattggcgtgctggtatggaagaatgataagcggcagctgttctttgctagt
aagcatgagcagttgagagattatttgaagagtcggaagaagggggagtag

DBGET integrated database retrieval system