KEGG   Sordaria macrospora: SMAC_00939Help
Entry
SMAC_00939        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
smp  Sordaria macrospora
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SMAC_00939
Enzymes [BR:smp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SMAC_00939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1423 aa AA seqDB search
MESLSNLSIAVSSVLSDTTSMNATAILADPTEALSSVVALASDAVIKANDVVPEHTSASW
FTIILWLLHLISSVLYFVLKLATISTPTFLFNIFSTSLTVTMNATTLVFIMLFMMGGVTW
LVRYRYLNMYSRLPPEPQRKEPAVDLFPETQEEGVKSGLASYFDEFLSAIKIFGYLERPV
FHELTRSMQTRKLIAGETLNLEEEQGFCLVVDGMVEIFVKSARDGRYSASGPSFETSSDD
EEGFAQSRQRYQLLTEVRNGAPMSSLFSIMSLFTEDIQMNDTDDDDDDGPGPTPSAAGTA
MPGYPRNANFQQSNDTLPSIPAQNTSRIPPLSLANTRPAIPRRPVPKRLNTTSAHPDIIA
RATVDTTIAIIPASAFRRLIKIYPKATAHIVHVILSRFQRVTLATAYNYLGLSGEVLQME
RSMLKYTVRQLPNHLRGDALDRLKENAGDLLLNTQQMKSGTASQLDMARDATSPRPQRNL
SPFSTPRNAHVSLDTREALDEDDLFRESVLECMFRAIGLTGNGSVNPDSTQASPRFAPMD
QRHSRAGRGHTAFGFMDAFDPFDNDTESVTSGGFNSSSPVPNPQLLAHDMKDEVEIVFFP
KGSVLVEQGERNPGLYYVIDGFLDICVPGDDSSHDLLQSSAKVDHGHGSTTGADAFGANS
SPFPEPNMNNNFGAEQKKGKQGRRSVALIKPGGLAGYVGTISSYRSFIDVVARTDVCVGF
LPLASIERIVDRYPIVLLTMAKRLTELLPRLLLHIDFALEWVQVNSGQVLFREGDESEAI
YLVLNGRLRLVEDQKEGGMNVKAEFGQGESIGELEVLTESSRTGTLHAIRETELVKFPRT
LFNSLAQEHPNITIKISKIIAARMRAFIDDPSRMGLKDNAVRSYKSSSTLNLRTVAILPV
TAGVPVVEFGNRLMSALSQVGLPNGATCLNQAAILNHLGKHAFNKMGKLKLSQYLADLEE
KYGLVVYVADTNVNTPWTQTCITQADCLLFVGLADSSPEIGEYERFMLGMKSTARKILVL
VHQERYSNPGLTRQWLKNRMWINGGHFHVQMAYTPNTVPIHQPTKRFGPSLKQRVQILQA
EIQKYTSRKVRHVPFYSPDAPFKGDFHRLARRLCGKSVGLVLGGGGARGIAHIGIIRAME
EAGIPIDMVGGTSIGAFVGGLYARYADVVPIFGLAKKFAGRMASMWRFAFDLTYPSASYT
TGHEFNRGIFKTFGKTQIEDFWLEYYCNTTNISKSRVEFHTSGYAWRYIRASMSLAGLLP
PLCDEGSMLLDGGYIDNLTVSRMKSLGSDVIFAVDVGSLDDNTPQAFGDSLSGVWAFFNR
WNPFSSVPNPPTLAEIQARLAYVSSVGELERAKTMPGCIYMRPPIDDYGTLDFGKFDEIY
GVGYRYGQEFLQKLREQGVLPLAEETEAKKALRRTMAPRRASI
NT seq 4272 nt NT seq  +upstreamnt  +downstreamnt
atggagtctcttagcaacttgagcattgccgtgagctcggtgctttccgacacgacctct
atgaatgcgaccgcaatcctcgccgatcctacagaagccctctcgtctgttgtcgctctc
gccagcgatgcggtcatcaaggctaacgatgtggttcccgagcacacctcagcatcatgg
ttcaccatcatcctctggctcttgcacctcatctcgagtgtgctatactttgtcctcaag
ctggccaccatctctacacccaccttcttgttcaacatcttttcgactagtctgaccgta
accatgaacgctactacgcttgtgtttataatgctgttcatgatgggaggagtcacttgg
ctggtcaggtatcgctacttgaacatgtactcgcggcttcctcctgagccccagcgcaag
gagccagccgttgacctgttccccgaaacacaggaggaaggggtaaagtccgggctagcc
agctactttgacgagttcctcagcgccatcaagatattcggttatctggaaaggccggtt
tttcacgaactgacccgcagcatgcagacgaggaagctgatcgctggcgaaaccctcaac
ctcgaagaagagcaaggattctgtcttgtggtcgatggtatggtggagatctttgtcaaa
tccgccagagatggtcgatactcagccagtggcccttcgttcgagacaagtagcgacgat
gaggagggctttgctcagagtcgccagcgttaccagcttctgaccgaagtgcgaaatggg
gcccccatgtcatcactgttctctatcatgtcactctttaccgaagacatccaaatgaac
gacacggacgacgacgatgacgacggccccggcccaacgccttccgctgctggaactgct
atgcctggctaccctaggaacgccaacttccagcagtcgaacgatacgctcccgtccatc
ccagctcagaacacttcgaggataccaccactttctctcgcgaacactcgtcctgctata
ccccgtcggccagtaccgaaaagactcaataccacctcagcccacccggatattattgcg
agagcgacagtggacaccaccatagccatcatccccgccagtgccttcagacgtctgatc
aagatatatcccaaggcgactgcccacatcgttcatgtcatcctttcgaggttccagaga
gttacacttgcgactgcttacaactatctcggtttgagcggcgaagtcttgcagatggag
cgcagcatgttgaaatatacagttcggcagctccccaatcatctccgaggagacgctttg
gacagactcaaggaaaacgccggcgatttgcttttaaatacgcaacaaatgaagtctgga
acggcgtcgcagcttgatatggcgcgagacgccacatctccccggccacagcgaaatctc
agtcccttctctactccccgcaacgcacatgtctcgcttgacacaagagaggcccttgat
gaagacgatctgttcagagagtcggtgcttgaatgcatgttcagggccattggcctgacc
ggtaacggcagtgtcaatccagattccacgcaagcttcccccagattcgctcctatggat
cagcgacattcgagggctggccggggccatactgcatttggcttcatggatgctttcgac
ccatttgacaacgacacggagtcagtcacctcaggtggatttaactcatcgtcgccagtt
cccaatccccaactattagcacacgacatgaaggacgaggttgagatcgtcttctttccc
aagggctctgtcttggtggagcaaggcgagaggaatcccggtctctattatgttattgat
ggtttcctcgacatttgcgtcccgggcgacgattcatcacacgacctcctccaatcatca
gccaaggtagaccatggccacggttcaacaactggtgctgacgcgtttggagccaactcg
tcgccctttccagagccgaacatgaacaacaactttggtgctgagcagaaaaagggcaaa
cagggtcgaagaagcgtggctctgatcaagccgggtggacttgctggttatgtcggcacc
atttcctcctacagatcgtttatcgatgttgttgcgagaacggatgtctgtgtcggtttt
ctcccactcgcgtccatagagaggattgttgaccgctatcccatcgttcttcttaccatg
gccaagcggcttaccgagttgctgccgcgcctgcttctgcacattgactttgctcttgag
tgggtgcaggtaaactccggtcaggttttgttccgtgaaggtgatgagagcgaagctatc
tatcttgttctgaatggccgattgagactggtcgaagatcagaaagagggtggaatgaac
gtcaaagctgaattcggtcagggagagagtatcggagaactggaagtgctgaccgaatcc
tcacgtaccggaactctacatgcgatccgcgaaactgaactggtgaagttccctcggaca
ctgtttaacagcttggcccaagagcatcccaacatcactatcaagatctccaagattatc
gcagctcgaatgagggcctttatcgacgatccttcgcgtatgggactcaaagacaatgcg
gttcgaagctacaagagctcatcaaccttaaatttgaggactgtggcaatcttacctgtc
accgcgggtgttcctgtggtcgagtttggcaataggttaatgagcgccttatcacaagtt
ggacttcctaatggggcgacttgtttgaaccaagcagcgattctaaaccacctcggaaaa
cacgcattcaacaagatgggaaagctcaagctgtcgcagtacctcgccgatctcgaagag
aaatatggactggttgtctacgtagctgacacgaacgtcaacacgccatggacccaaaca
tgcatcacgcaagctgattgcttgttatttgtcggccttgcggacagctcccctgagatc
ggagagtatgagcgcttcatgcttggaatgaaatcgacggcccgcaagattcttgtcctg
gttcaccaagagcgttactccaaccctggtttgacgaggcaatggctgaagaaccggatg
tggattaacggaggccacttccatgttcagatggcatatacccccaacacggtgcctatc
catcagcccacgaaacgattcgggccaagcctcaagcagcgggttcagatcctgcaggca
gagatccaaaagtacacctcccgaaaagttcgccacgttcccttctactcccccgatgct
ccgttcaagggagacttccatcggttggcgaggcggttgtgcggcaagtctgtgggtctc
gtcctgggtggtggtggcgccaggggcattgcgcacatcggcatcatcagagcgatggaa
gaggccggaatccccattgatatggtcggaggaacatcaatcggagccttcgtcggcgga
ttatacgccagatatgcggatgtggttcccattttcggtctggccaagaagttcgctggg
cgtatggcaagcatgtggaggttcgcctttgacctaacctatccgtccgcctcctacaca
accggccacgagttcaaccgtggcattttcaagacctttggaaagacgcagattgaagat
ttctggctggaatactactgcaacaccacgaacatcagcaagagccgagtcgagttccac
accagtggttacgcatggcgctacatcagagcgtccatgtccctggcgggcttactccca
cctctgtgcgacgaaggcagcatgcttttggacggtggctacatcgacaatctgacggta
tctcgcatgaaatctctcggctcagatgtcatcttcgctgttgacgtcggctcgctcgat
gacaacacaccgcaggcctttggcgactcactgtctggtgtatgggcattcttcaaccgc
tggaatccattttcgtcggtacccaatccgcccacgctggcagaaatccaagcccgtctt
gcgtacgtgtcgagtgtcggtgagctggaaagggcaaagacaatgcctggatgcatttac
atgcgccctccgattgatgactatggaacgctggactttggcaaatttgacgagatctat
ggggtcgggtacagatatggccaggagttcctccagaagttgagggagcagggtgtgttg
ccactggcagaggagacggaggcaaagaaagcgttgaggagaaccatggcgcccaggcgt
gcgagtatatag

DBGET integrated database retrieval system