KEGG   Sordaria macrospora: SMAC_00958Help
Entry
SMAC_00958        CDS       T01610                                 

Definition
(RefSeq) hypothetical protein
  KO
K05759  
profilin
Organism
smp  Sordaria macrospora
Brite
Membrane trafficking [BR:smp04131]
 Others
  Actin-binding proteins
   Others
    SMAC_00958
Cytoskeleton proteins [BR:smp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     SMAC_00958
Exosome [BR:smp04147]
 Exosomal proteins
  Proteins found in most exosomes
   SMAC_00958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 133 aa AA seqDB search
MSWQAYVDTSLVGTGHLDKGAIISAAGDSTWAATSGFTLSPEEMKFIAAVVAENGSGPNV
NKVFAEGIHVGGQRYVAFNIEGRHIYGRQGKTGVIIVKTTQAILVAHYGENNTAGNSTQT
VEALADYLIKSGY
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaagcctatgttgacacgagccttgttggcaccggccacctcgacaagggc
gccatcatcagcgccgctggtgacagcacctgggctgcgacttccggcttcacgctgagc
cccgaggagatgaagttcatcgccgccgtcgtcgccgagaacggctcgggccccaacgtc
aacaaggttttcgccgagggtatccacgttggcggtcagcgctacgttgccttcaacatt
gagggccgtcacatctacggtcgtcagggcaagactggtgtcatcatcgtcaagacgaca
caggccatcctcgtcgcccactacggcgagaacaacactgccggcaactcgacacagacc
gttgaggcgctcgccgactacctcatcaagtccggatactaa

DBGET integrated database retrieval system