KEGG   Sordaria macrospora: SMAC_00958Help
Entry
SMAC_00958        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
smp  Sordaria macrospora
Brite
Exosome [BR:smp04147]
 Exosomal proteins
  Proteins found in most exosomes
   SMAC_00958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 133 aa AA seqDB search
MSWQAYVDTSLVGTGHLDKGAIISAAGDSTWAATSGFTLSPEEMKFIAAVVAENGSGPNV
NKVFAEGIHVGGQRYVAFNIEGRHIYGRQGKTGVIIVKTTQAILVAHYGENNTAGNSTQT
VEALADYLIKSGY
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaagcctatgttgacacgagccttgttggcaccggccacctcgacaagggc
gccatcatcagcgccgctggtgacagcacctgggctgcgacttccggcttcacgctgagc
cccgaggagatgaagttcatcgccgccgtcgtcgccgagaacggctcgggccccaacgtc
aacaaggttttcgccgagggtatccacgttggcggtcagcgctacgttgccttcaacatt
gagggccgtcacatctacggtcgtcagggcaagactggtgtcatcatcgtcaagacgaca
caggccatcctcgtcgcccactacggcgagaacaacactgccggcaactcgacacagacc
gttgaggcgctcgccgactacctcatcaagtccggatactaa

DBGET integrated database retrieval system