KEGG   Sordaria macrospora: SMAC_01003Help
Entry
SMAC_01003        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
smp  Sordaria macrospora
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SMAC_01003
Enzymes [BR:smp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SMAC_01003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 793 aa AA seqDB search
MRWLPLFLGAARLAVAASTTTTTEAEDDVAEYTKFNDVSIPPLIELTPDNWEKESKASKW
LMVKHYSPYCPHCIDFAPTYQTLYEFYYTSKPVGNENANFTNFYDFRFGTINCVAYYDLC
SAHKASSYPTTTLYKNGEQAETLKGVKSMVVLSEVVEKALEETKPGTRPAKLELPKPGDT
SAPGFVSKVGTLKETTEEATKVDSAKDVPKVDLVKDSAKVEQPEKDTFITGNDEYLMPTP
KAEEKPMDKVVEKVADKATETKAASKADPSVEAKAKIEKAKEEEKKSTPAAYYEAPAAAA
AAAASIKGNKPKSTPNPNGISQPLTAESFQSQVTMTQEPWFIKFYAPWCHHCQAMAANWA
QVAREMKGRLNIGEVNCEQEQRLCKDVRVTGYPTIQFFRGGERVEYTGLRGLGDFLAYAE
KAIDISKGVQDVDAASFKALEEKEEVIFVYFYDHATTTEDFLALERLPLSLIGRAKLVKT
RDPEMYDRFKITTWPRLLVSREGRPTYYQPLTPNEMRGTRQVLNWMKSVWLPIVPEMTAS
NAREIMDGKIVVLGLLNRDDEESFTGAIREMKSAANEWMDKQIQLFQLERQELRNAKQLR
IEEAEDRNDQRALRNAKNIRINMDRADRKEITFAWVDGTFWQRWIRTTYGIDVKDTGDRI
IINDEDNRRYWDQTTTGNPIVPSRTSILETITKISQNPLNIKPKLTISAFEKIFFDIRMT
FSEHPYLTMGCILGIAFGCLSWFRNSARAQRRGTHFKLEEGGVSAPTEKGSSGGFIQSVF
GGSGGSSNGPKAD
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggcttccccttttcttgggcgcggcccgtctggccgttgccgcatcaaccacc
acaacaacagaagcagaggacgacgtggcagagtacaccaagttcaacgatgtatcgata
ccaccacttatcgagctcacccccgacaattgggagaaggaatcgaaagccagcaagtgg
ctgatggttaagcactacagcccctactgcccccactgcattgactttgctcctacatat
caaacattatacgagttctactacacatcaaagcccgtcggaaacgagaacgcgaacttt
accaacttctacgacttccgcttcggcaccatcaactgcgtggcgtactacgatctgtgc
agcgcgcacaaggcatcttcctacccaacgactactctctacaagaatggcgaacaggcc
gagactcttaagggcgtcaagtccatggttgttctgagcgaggttgtagaaaaggctctt
gaagagaccaagcccggaacgagacccgcgaagctcgagctccccaagcccggcgatacc
tctgctcctggctttgtctccaaggtcggcaccctcaaggagaccaccgaggaggctacc
aaggttgattccgccaaggatgtgcccaaggtcgatctcgtcaaggactccgccaaggtc
gaacaacctgagaaggatacttttatcaccggaaacgacgagtacttgatgcctactccc
aaggccgaggagaagcccatggacaaggttgtggaaaaggtggcggacaaggccacggaa
accaaggccgcctccaaggcggacccttctgttgaggccaaggccaagatcgagaaggcc
aaggaggaggagaagaagtctacgcctgctgcttactatgaggcccctgctgccgctgcc
gctgccgctgcctccatcaagggcaacaagcccaagtctactcctaaccccaatggtatc
tctcagcccctcactgccgagagcttccagagccaggtcaccatgacccaggagccttgg
ttcatcaagttctacgccccttggtgccatcactgccaagccatggccgccaactgggct
caggtcgctcgcgagatgaagggccgcctcaacattggcgaggttaactgtgagcaggag
cagcgcctctgcaaggacgtccgcgtcaccggttaccccaccattcagtttttccgtgga
ggcgagcgcgtcgagtacactggcctccgtggtctcggcgatttccttgcctatgccgag
aaggcaattgacatctccaagggcgtacaagacgtggatgctgcttctttcaaggctctc
gaggagaaggaggaggtcatctttgtttacttctacgatcatgccaccaccaccgaggac
ttcctcgcccttgagcgtcttcctctcagccttatcggccgtgccaagctcgtcaagacc
cgcgaccccgaaatgtacgatcgcttcaagatcaccacctggccccgtctgctcgtctct
cgcgagggccgccccacttattaccagcccctcacacccaacgagatgcgcggcactcgc
caggttcttaattggatgaagtccgtttggctgcccatcgttcccgagatgaccgcctcc
aacgcccgcgagatcatggatggcaagatcgttgtcctcggactccttaacagagatgac
gaggagtcgttcactggcgccattcgcgagatgaagtcggccgccaacgagtggatggat
aagcagatccagctcttccagctggaaaggcaggagctccgtaacgcgaagcagctgcgc
atcgaggaggccgaggaccgcaacgaccagcgtgctttgcgcaacgctaagaacatccgc
atcaacatggacagggcggacaggaaggagattacctttgcttgggttgatggcactttc
tggcagaggtggatcaggaccacgtacggtattgatgtcaaggatactggtgaccggatc
atcatcaacgatgaggataaccgccgctactgggaccagaccaccaccggcaaccccatc
gtccccagccgcacctccatcctcgagaccatcaccaagatctcccagaacccgctcaac
atcaagcccaagctcaccatctccgcctttgagaagatcttcttcgacatccgcatgacc
ttctcggagcacccctaccttaccatgggctgcatcctcggcatcgccttcggctgcctc
tcgtggttccgcaacagcgctcgcgcccagaggaggggcacccacttcaagctggaggag
ggcggtgttagtgctcctaccgagaagggaagctccggcggcttcattcaaagcgtgttt
ggcggcagcggtggtagcagcaatggacccaaggccgattaa

DBGET integrated database retrieval system