KEGG   Sordaria macrospora: SMAC_01050Help
Entry
SMAC_01050        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
smp  Sordaria macrospora
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:smp00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 194 aa AA seqDB search
MAPILPPDRRPVVISGPSGVGKGTLFKLLFERHPDTFTLSVSHTTRGPRPGEKDGVDYHY
VTKEAFEELKAKGGFVESAQFGSNFYGTSKATIEEQSAKGKVVVLDIEMEGVKQIQASGF
PARYVFIAPPSEEELEKRLRGRGTDKEEEVLKRLAQAKNELAFSKTNVHDKIIVNDDLEK
AYKELEEFVYTPVA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcccattctccctcccgaccgtcgccccgtcgtcatctccggcccctctggcgtc
ggcaagggcaccctcttcaagctcctgttcgagagacaccccgataccttcactctttcc
gtgtcgcataccacccgcggccccagaccaggcgaaaaggatggcgttgactaccactat
gtcaccaaggaggctttcgaggagttgaaggccaagggcggtttcgtcgagagtgcgcag
ttcggcagcaacttctacggaaccagcaaggccaccatcgaggagcagtccgccaagggc
aaggtcgtcgtcctcgacatcgagatggagggtgtcaagcagatccaggcttctggcttc
cccgcccgttacgtcttcatcgctcccccatccgaggaggagcttgagaagagactccgc
ggccgcggcaccgacaaggaggaggaagttctcaagagactggcccaggccaagaacgaa
ctcgctttcagcaagaccaatgtccatgacaagatcatcgtcaacgatgatctcgagaag
gcctacaaggagctcgaggagttcgtctataccccggtcgcctaa

DBGET integrated database retrieval system