KEGG   Sordaria macrospora: SMAC_01050Help
Entry
SMAC_01050        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
smp  Sordaria macrospora
Pathway
smp00230  Purine metabolism
smp01100  Metabolic pathways
Module
smp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SMAC_01050
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SMAC_01050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 RsgA_GTPase MMR_HSR1 AAA_22 ABC_tran AAA_28 ATPase_2 AAA_14 DUF3987 AAA_29
Motif
Other DBs
NCBI-GeneID: 10807666
NCBI-ProteinID: XP_003350159
UniProt: F7VNU8
Position
Unknown
AA seq 194 aa AA seqDB search
MAPILPPDRRPVVISGPSGVGKGTLFKLLFERHPDTFTLSVSHTTRGPRPGEKDGVDYHY
VTKEAFEELKAKGGFVESAQFGSNFYGTSKATIEEQSAKGKVVVLDIEMEGVKQIQASGF
PARYVFIAPPSEEELEKRLRGRGTDKEEEVLKRLAQAKNELAFSKTNVHDKIIVNDDLEK
AYKELEEFVYTPVA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcccattctccctcccgaccgtcgccccgtcgtcatctccggcccctctggcgtc
ggcaagggcaccctcttcaagctcctgttcgagagacaccccgataccttcactctttcc
gtgtcgcataccacccgcggccccagaccaggcgaaaaggatggcgttgactaccactat
gtcaccaaggaggctttcgaggagttgaaggccaagggcggtttcgtcgagagtgcgcag
ttcggcagcaacttctacggaaccagcaaggccaccatcgaggagcagtccgccaagggc
aaggtcgtcgtcctcgacatcgagatggagggtgtcaagcagatccaggcttctggcttc
cccgcccgttacgtcttcatcgctcccccatccgaggaggagcttgagaagagactccgc
ggccgcggcaccgacaaggaggaggaagttctcaagagactggcccaggccaagaacgaa
ctcgctttcagcaagaccaatgtccatgacaagatcatcgtcaacgatgatctcgagaag
gcctacaaggagctcgaggagttcgtctataccccggtcgcctaa

DBGET integrated database retrieval system