KEGG   Sordaria macrospora: SMAC_01184Help
Entry
SMAC_01184        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
smp  Sordaria macrospora
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smp00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 565 aa AA seqDB search
MGDVRQLQEEHAAAMAKTSAQEPSIQAVTSQATATSSASGKNVDILELPAVTLTCEKGEL
VIQVTQMPDKEEEAQTSTGFLNYIPLDGLDGILTPFFPSSTVTPPRRLPPGSVPFYNILW
AYITPDRNYLRIDFAEETSPKKHQLIVRQLEFPLPSAPSQAPERESLLSPTILSPSAATL
DAFVSRLLDLAYPAPIQRRKRAWVLVNPQAGPGGADKIFEKEVRPIFEAARMPLTIIRTT
YSGEAVTLSQDLDISQYDIAVPCSGDGLPHEVFNGLSKRSDARRALARVAVCHIPCGSGN
AMSCNLYGTHRPSLAALAIVKGVPTKLDLCSVTLQDGERLTSFLSQAYGMIADLDITTEH
LRWMGAARFTYGFLTLAIRKKTYPCDVAMKVEVDGKGEIKGHYARGVRSTEGEVENGEAS
GDGLGEEDGAGEEGEEGGAGLKMAYMAPDANFFSAALANDGLLDLITTDGDISLWKNINM
QLSVESGHFFDNPLVSYRKVSAFRLTPRYQDPNGVISIDGEARPFAPFQVEVHKGLGLTL
SKRGVFEAPGPHGWDKVSTTERLMA
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgtccgacaattacaggaggaacacgcggcggccatggcaaagacgagcgca
caagagccgtctatccaggccgtgacatcgcaagccactgcaacttcttctgcttccgga
aagaatgtcgatattctcgaactgcccgccgtcacactcacctgcgagaaaggtgaattg
gtaattcaagtcacacaaatgcccgataaggaagaagaggcccagacctcaaccggattc
ctaaactacatccctctcgacggtctcgacggcatactaaccccgttcttcccctcctcc
acagtcacccctccgcgtcgtcttcctccggggtccgtcccgttctacaacatcctctgg
gcctacatcaccccagaccgcaactacctccgcatcgacttcgccgaagagacatcaccc
aagaagcatcaacttatcgtccgccaactcgagttccctctcccctcagctccctcccaa
gctcccgagcgcgaatcacttttgtcccccaccattctatcgccctcggccgccacgctg
gacgccttcgtctcccgccttctcgacctcgcctaccccgcgcccatccaacgccgaaag
cgcgcctgggttctcgtcaacccccaggctggcccaggcggcgctgacaagattttcgaa
aaggaagtccgtcccatcttcgaagcggcccgcatgccgctcaccatcatccgcaccact
tactcgggtgaagccgtcaccctgtcccaagacctcgacatatcccagtacgacatcgca
gtcccttgctccggcgacggcctaccacacgaagttttcaatggtctttccaagagatcc
gacgcccgccgtgctttggcgagggtagcagtgtgccacatcccctgcggctccggaaac
gccatgtcctgcaacttgtacggcacgcaccgcccttcgctggcggcgctggcgattgtg
aagggcgtgccgacgaagctggacctgtgcagcgtcacgttgcaggatggagagcgcctg
acgagcttcttgagtcaggcgtacggcatgattgctgatctggatatcacgacggaacat
ctgaggtggatgggggcggcgaggttcacgtacgggttcttgacgctggccatcaggaag
aagacgtatccatgtgatgtggcgatgaaggtggaggtggatgggaagggggagattaag
gggcattatgctaggggggtgaggagcacggaaggggaagttgagaacggggaagctagc
ggggatgggcttggggaagaggatggtgcaggagaggagggagaagaggggggtgccggg
cttaagatggcctacatggccccagacgccaacttcttctccgccgccctcgccaacgac
ggcttgctagatctgatcaccaccgacggcgacatttctctctggaagaacatcaacatg
caactttctgtcgaatctggtcacttcttcgataaccccctggtttcttaccgcaaagtg
tccgctttccggttgacgccccggtaccaggacccgaacggcgtgattagcatcgatggc
gaggcgagaccgtttgcgccgttccaggtggaggtgcataagggtcttggactgactctc
agcaagaggggcgtgtttgaggcgccggggccgcatgggtgggataaagtttcgacgacg
gagaggttgatggcctaa

DBGET integrated database retrieval system