KEGG   Sordaria macrospora: SMAC_01184Help
Entry
SMAC_01184        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
smp  Sordaria macrospora
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SMAC_01184
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     SMAC_01184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 565 aa AA seqDB search
MGDVRQLQEEHAAAMAKTSAQEPSIQAVTSQATATSSASGKNVDILELPAVTLTCEKGEL
VIQVTQMPDKEEEAQTSTGFLNYIPLDGLDGILTPFFPSSTVTPPRRLPPGSVPFYNILW
AYITPDRNYLRIDFAEETSPKKHQLIVRQLEFPLPSAPSQAPERESLLSPTILSPSAATL
DAFVSRLLDLAYPAPIQRRKRAWVLVNPQAGPGGADKIFEKEVRPIFEAARMPLTIIRTT
YSGEAVTLSQDLDISQYDIAVPCSGDGLPHEVFNGLSKRSDARRALARVAVCHIPCGSGN
AMSCNLYGTHRPSLAALAIVKGVPTKLDLCSVTLQDGERLTSFLSQAYGMIADLDITTEH
LRWMGAARFTYGFLTLAIRKKTYPCDVAMKVEVDGKGEIKGHYARGVRSTEGEVENGEAS
GDGLGEEDGAGEEGEEGGAGLKMAYMAPDANFFSAALANDGLLDLITTDGDISLWKNINM
QLSVESGHFFDNPLVSYRKVSAFRLTPRYQDPNGVISIDGEARPFAPFQVEVHKGLGLTL
SKRGVFEAPGPHGWDKVSTTERLMA
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgtccgacaattacaggaggaacacgcggcggccatggcaaagacgagcgca
caagagccgtctatccaggccgtgacatcgcaagccactgcaacttcttctgcttccgga
aagaatgtcgatattctcgaactgcccgccgtcacactcacctgcgagaaaggtgaattg
gtaattcaagtcacacaaatgcccgataaggaagaagaggcccagacctcaaccggattc
ctaaactacatccctctcgacggtctcgacggcatactaaccccgttcttcccctcctcc
acagtcacccctccgcgtcgtcttcctccggggtccgtcccgttctacaacatcctctgg
gcctacatcaccccagaccgcaactacctccgcatcgacttcgccgaagagacatcaccc
aagaagcatcaacttatcgtccgccaactcgagttccctctcccctcagctccctcccaa
gctcccgagcgcgaatcacttttgtcccccaccattctatcgccctcggccgccacgctg
gacgccttcgtctcccgccttctcgacctcgcctaccccgcgcccatccaacgccgaaag
cgcgcctgggttctcgtcaacccccaggctggcccaggcggcgctgacaagattttcgaa
aaggaagtccgtcccatcttcgaagcggcccgcatgccgctcaccatcatccgcaccact
tactcgggtgaagccgtcaccctgtcccaagacctcgacatatcccagtacgacatcgca
gtcccttgctccggcgacggcctaccacacgaagttttcaatggtctttccaagagatcc
gacgcccgccgtgctttggcgagggtagcagtgtgccacatcccctgcggctccggaaac
gccatgtcctgcaacttgtacggcacgcaccgcccttcgctggcggcgctggcgattgtg
aagggcgtgccgacgaagctggacctgtgcagcgtcacgttgcaggatggagagcgcctg
acgagcttcttgagtcaggcgtacggcatgattgctgatctggatatcacgacggaacat
ctgaggtggatgggggcggcgaggttcacgtacgggttcttgacgctggccatcaggaag
aagacgtatccatgtgatgtggcgatgaaggtggaggtggatgggaagggggagattaag
gggcattatgctaggggggtgaggagcacggaaggggaagttgagaacggggaagctagc
ggggatgggcttggggaagaggatggtgcaggagaggagggagaagaggggggtgccggg
cttaagatggcctacatggccccagacgccaacttcttctccgccgccctcgccaacgac
ggcttgctagatctgatcaccaccgacggcgacatttctctctggaagaacatcaacatg
caactttctgtcgaatctggtcacttcttcgataaccccctggtttcttaccgcaaagtg
tccgctttccggttgacgccccggtaccaggacccgaacggcgtgattagcatcgatggc
gaggcgagaccgtttgcgccgttccaggtggaggtgcataagggtcttggactgactctc
agcaagaggggcgtgtttgaggcgccggggccgcatgggtgggataaagtttcgacgacg
gagaggttgatggcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system