KEGG   Sordaria macrospora: SMAC_01279Help
Entry
SMAC_01279        CDS       T01610                                 

Gene name
os5
Definition
OS5 protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
smp  Sordaria macrospora
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:smp04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 695 aa AA seqDB search
MSDHDPDHAPASPNEYDDESNPASPGSVDESSEASTPMDPPSSGSDAMPGFAPEADLARR
VPSLRTISDPQTTLMNPSSSVPGTLNAARRPAASAANLPTDLMAKARALHQQRMGMAPRP
GMSPQNSGLGMSPMGSGMGGMGGMGGMGGMGGMGGMGGMGGMGHSMNLNMNNMNHGGPAP
GGLRLPQGITRPPPQGFPKSAPAISGVGKKAPSLSERRAMKLGGLPGVPGSPAGGTPKLS
DMGSDDSKAPAINGEGRGSKLSDFKNYIDAENGWITFADAATITRTGVNFANGQTFKISL
DEVEVMDELGKGNYGTVYKVRHTKPKLPRFGQGLSNKQSLSRQASASDADVSDNSPLSPV
AAASRGTSGKVMAMKEIRLELDESKFSTILKELVILHECASPFIIDFYGAFYQEGAVYMC
IEYMDGGSIDKLYAGGIPENILRKITYATIMGLKCLKEDHNIIHRDVKPTNILVNTNGQV
KICDFGVSGNLVASIAKTNIGCQSYMAPERISGGGMSAAGGAADGTYSVQSDIWSLGLTI
IECAMGRYPYPPEVSSTIFSQLSAIVEGDPPDLPADGYSGTAKDFVKSCLNKIPAKRHTY
PMLLMHPWIKSLGRPETIAEEVEAEEKAADDQLADATGTLDINSNGPINDHGDREVAEWV
TNVLDRKHKGLLPGQVEKPALHAAPLDQVSPGITV
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccacgaccccgatcacgccccggctagcccgaacgagtatgacgatgagagc
aacccggcttctccgggctcagtcgacgagtcgtcagaagcaagcacgcccatggacccg
ccaagctcaggttcagatgcgatgcctggcttcgcaccagaagccgatctggcccgcaga
gtgccatcgctacggaccatctccgacccacaaacgactctgatgaaccccagttcgagt
gttcctgggacactgaatgccgcccgaagacctgcggcgtccgcggcaaaccttccaacg
gacctcatggcaaaggcacgggctctacatcaacaacggatgggcatggctcccagacct
ggcatgtcgccccagaatagtggactgggcatgagccccatgggatcaggtatgggaggc
atgggaggcatgggagggatgggaggcatgggaggcatgggcggcatgggtggcatggga
gggatgggacacagcatgaacttgaacatgaacaacatgaaccacggtgggccggcacca
ggtggccttcggttaccgcaaggcatcacacgaccaccaccccaaggcttccccaaatcc
gcacctgctatctctggtgtgggcaaaaaagcccccagtctgagcgaacggcgagcaatg
aagctcggagggttaccaggagtgcctgggtcacccgcgggtggcacgccgaaactctca
gacatgggttccgatgactccaaagcgccagccattaatggagaaggccgcgggtcgaag
ctgagcgatttcaagaactatatcgacgcagagaacgggtggatcacttttgcagatgca
gcaactatcacacggacaggcgtcaatttcgccaacggacagaccttcaaaatctcgcta
gacgaggtagaagttatggacgagctaggcaagggcaactatggtaccgtctacaaagta
cgacatactaagcccaagctcccacgctttggacaaggcttgagcaacaagcagtcgtta
tctcgacaagcatcggcgtcagatgctgacgtttctgataactccccactaagtcctgtt
gctgccgcttcgcgtggcacttcaggcaaggtcatggctatgaaggagatcaggctcgaa
ctggacgagtccaaattttccaccattctcaaggaactcgtaattcttcacgagtgcgcc
tcgcccttcatcatcgatttctacggtgccttttaccaagaaggcgcggtatacatgtgc
atcgagtacatggacggcggcagtatagacaagctatacgcgggagggatccccgagaat
atcttacgcaagattacatatgcgacgattatgggtcttaagtgcctgaaagaagatcac
aacatcatccatcgcgatgtcaagcccaccaacattctggtcaacacgaatggacaggtc
aagatctgcgattttggcgtttcgggcaatctcgttgccagtatagcaaagaccaacatt
ggctgccagagttacatggcaccagaacgcatcagcggtggtggcatgtcagctgcgggc
ggcgcggccgacgggacttatagcgtacaaagcgatatttggagtttgggtctcaccatc
atcgagtgtgccatgggtcggtacccgtacccgcctgaggtttctagcacaatcttcagt
caactcagtgccatcgttgagggtgaccctcctgacctccccgctgatggctactccggc
acggcaaaggactttgtcaagtcctgtctcaacaagattcctgccaagcgccacacatac
ccgatgctgctgatgcacccctggatcaagtccctcggcaggcccgagaccatcgcggaa
gaagtagaagccgaagagaaggccgccgatgaccagctcgccgacgccaccggtactctc
gacatcaacagcaacggaccgatcaacgaccatggagatcgtgaggtggctgagtgggtc
accaacgtcctggaccgaaaacacaagggcttgctccctggtcaggttgagaagccggct
ctccacgctgcgccgctggatcaagtgagcccgggtattacggtttag

DBGET integrated database retrieval system