KEGG   Sordaria macrospora: SMAC_01305Help
Entry
SMAC_01305        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
smp  Sordaria macrospora
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1474 aa AA seqDB search
MTAVSLHASHPGSAEFGQRQPSAPTPDSGRYARPGPSSASTASSPSRHTMNNPARQSSVT
MSQVHPQRPEDGNQRVVTDGTSHPAAHNQLPLRFNIQRRMSDSSPAPMFRRPSSAPDDNN
QTSPGTTLHGGQSDDDDHVPVARPAKPPLLRSKSEHGLRLERESPVEQVDEEYHDWGARH
GFEDHYQSEEVISQLANSWYMYYTDKRHETTGKPKTPAFEIQDWRMRDRLKTVSAAIAVC
LNIGVEPPDQLRTTPGARLEAWQDPTVPPVSKALENIGKALQSQYETLAIRTRYKQYLDP
SIEETKRFSISLRRSAKDERVLFHYNGHGVPKPTASGEIWVFNKNYTQYIPVSLYDLQQW
LQAPTIFVWDCSEAGNILSNFHRFVEKHEQEEEEAVQRDPNHEKISFRPYIHLAACSVKE
NLPTNPDLPADLFTSCLTTPIEMALWFFCLQNPLKTKISPERAKKLPGRLQERRTPLGEL
NWIFTAITDTIAWTTLPRHLFRKFFRQDLMVAALFRNFLLAQRIMPVYNCHPQSYPELPD
TRQHPLWESWDLAVDLALAQLPDLERKESEGIEYDYINSSFFAEQLTAFEIYLTRGDALS
QKPPDQLPVVLQVLLSQQHRVRALVLLARFLDLGPWAVQLALSIGIFPYVLKLLQSAAQD
LKPVMVFIWTRVLAVDISCQQDLIKDSGYNYFAAIMKPQDTLSMVSVGFLDEHKAMCAFI
LAMLCKDYKPGQLVCNSTDIMSYCLYHIARPEGPLLKQWSCLCISQLWKDLPEGKWRGIR
ENATAKLSHLSRDPNPEVRAAMAHAMTTFLGIPDLTDEVARIEESVAWTMLELATDGSPI
VRKELLVFFSHFVLRYESKFLVAAFEQLSEEKDYLASPPPEDGQDHRMGLHYARRENRER
DGSIKPTAFGVAHDSIFAACWKHINILSVDPHPETQRDATVIVDYVHNALLQSPLTTQTQ
NLMDEILRRSRKVSRGDMSQRSAAAGTHAAIAQPLPSPGLLKRTASYLFGPLMGTLDPSS
TSMPPVSPGLQRSGSRSSRKGPGLDSAPPEQNDQATSPANYHVANEPSCTGYKERSMKDL
PNLPLVSTFLDWSIEYFREPQMKASEAEEPGSHEYNERLWRRSRNEAVLRETQPQKTHAR
THKWNNQIGVINNGSQPAKLSFHQFENYVAVADDGNTVNVWDWKQGTRKSRFSNGNPEGS
KISDMKFINEDDQALLMTASSDGVIRIYRNYDTNENIELASAWRALTHMVPSNVNSGMVF
DWQQVKGQVLVAGDERVIRIWNAGHEMCTHEIPARSGSCVTSLTSDQMTGNIFVAGFGDG
AIRVFDTRMKPQETMVRKWKDEKRQWVRSVHMQRGGQRELLSASRNGKVRLWDIRMDQAL
KSFQTTKDVLRTASTHEHLPVFAVGTSAHLVKVFDFDGHELTRIEPYSSFLQGHKGTPIS
ATAFHPHRMVLGCAARGDYHVNLFACGNEKVGPF
NT seq 4425 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgtttctcttcacgcctcccaccccggttccgcagaatttggccagagacag
ccctcagctcccactcccgattctggccgttacgcgaggcccggcccttcgtcagcatca
actgcttcatctccatcccgccacacaatgaacaatccggcccgccaaagttcagtaaca
atgtcacaagtccatcctcagagaccagaagatggcaaccagcgcgtcgtgacagacggg
acctctcatcctgctgcccataaccagctgccacttcgattcaacatacagagacgcatg
tccgattcttcaccagcgcccatgtttcgacgcccctcaagcgcccccgacgacaataac
caaacatctcctggaaccaccttgcatggtgggcaatcggatgatgacgatcatgtacct
gtcgcccgaccggccaagccaccattactgcgatccaagagcgaacacggactgcggttg
gagagggaaagccccgtcgaacaggtggatgaagaataccatgactggggtgccaggcat
gggttcgaggaccattaccagtccgaggaagtaatctctcagcttgcaaatagctggtac
atgtactataccgataagcgacatgagacaacggggaagccaaagacacccgctttcgag
atccaagactggcgtatgcgcgatcgcctaaaaacagtctctgctgcgatagcagtgtgc
ctgaatataggagtggaaccgccagatcaacttcgcaccaccccgggcgccaggcttgaa
gcttggcaagatccaacggtgcctcctgtttccaaggcactcgagaatatcggcaaagct
ttgcaatctcagtacgagactctcgctatccggacacgctacaagcagtatttggacccg
tccatcgaagaaaccaagcggttcagtatctccctccgaagaagtgccaaggacgagcgt
gttctcttccattacaatggacatggagtacccaaaccaacagcttcgggggaaatttgg
gttttcaacaagaactatacgcagtatatccccgtctctctctatgaccttcagcaatgg
ttgcaggcacctacgatatttgtgtgggactgctccgaggcaggcaacatcctcagcaat
ttccaccgcttcgttgaaaaacacgaacaagaggaagaggaggcggtacaacgggacccg
aatcacgaaaagatcagcttccgtccttatattcacctggcagcctgcagtgtcaaggag
aatctgccaaccaaccctgacttgcctgccgatctctttactagttgcttgaccacccct
atagagatggcactctggttcttctgtctgcagaaccctcttaaaaccaaaatatctccc
gagcgagccaagaagctgccaggacggcttcaagagcgccggacgcccctcggagagctc
aactggatctttactgccatcacagacaccatcgcatggaccacgctaccacgccatctc
ttccgcaaattctttaggcaagatttgatggttgctgctcttttccgaaacttcctcctc
gcacagcgcatcatgcctgtgtacaattgccaccctcagtcgtaccccgagctgccagat
acacgtcaacatcccctttgggagagttgggacttggccgtcgatctggctcttgcccag
ttaccggacctggaaagaaaggagagtgaagggatagagtacgactacatcaactcgtca
ttctttgcggagcagcttacggcatttgagatctatctgactcgaggggatgccttatcc
cagaaaccacctgaccagcttccagtggttctgcaggtgttgctaagccagcagcatcga
gtacgagcactggttcttctggccagattcttggacttgggtccgtgggcagtgcaactg
gcgctgagcattggcatcttcccgtatgtcttgaagctcctccagtcggcggcgcaagat
cttaaaccggtcatggtgttcatctggacccgcgttcttgcggtcgacatctcatgccag
caagacctcatcaaggatagtgggtacaattacttcgcggccatcatgaagccgcaagat
accttatctatggtcagcgtcggcttcttggatgagcacaaggccatgtgtgctttcatc
ttggccatgctgtgcaaagactacaagcctggacaacttgtgtgtaactcgaccgacatc
atgtcctattgcttgtaccatattgcacgtccagaaggaccactcctgaagcaatggtca
tgcctctgcatcagccagctctggaaggaccttcctgaaggcaaatggaggggcattcgg
gagaacgccacggcgaagctctcccaccttagtagggaccccaatcctgaagtacgggca
gctatggcgcatgctatgaccacgttcctaggcatcccggacctgacggacgaagttgcg
aggatcgaggagagcgttgcctggacgatgcttgaattggccacagacggcagcccgatt
gtccgaaaagagcttctagtcttcttctcacattttgttctgcgctacgagagcaagttt
ctggttgccgcctttgagcaactatccgaggagaaggattatcttgcatccccgccacca
gaggatggccaggatcacaggatggggttgcactatgctcgtcgggaaaatcgggagagg
gatggcagcatcaagccaacagcatttggtgtagcgcacgattcaatctttgctgcatgc
tggaaacacatcaacattttgagcgtggatccacatcccgagacccagagagatgccact
gtcattgtagactatgttcacaatgcattgctccagtcaccgcttacgacgcaaacgcaa
aatctcatggacgagatcctccggcgctctagaaaggtgtcgaggggtgatatgagccag
agaagcgccgctgccggaacccacgctgcgatcgcacagccattaccttcgccaggcctt
ctcaagaggactgcaagttacttgtttggccccctcatggggaccttggacccttcttca
acctcgatgcccccggtgtcccctgggttacaaagaagcggatctcgaagcagccgaaaa
ggtccaggcctggattctgcgccgcctgagcaaaatgatcaggctacatcaccagcaaac
taccacgttgctaacgaaccgtcgtgtactggctataaggagcgcagcatgaaagatctg
cccaacttgccattggtgagcacgttcttggactggtcaatagagtacttccgcgagccg
cagatgaaagcatcggaggctgaggagcctgggagtcacgagtacaatgaacgcctgtgg
cgccgctcacgcaacgaggctgttctgagggagacccagcctcagaagacacatgcgcga
acccacaagtggaataaccaaattggcgtcatcaacaatggctcgcaaccggctaagctc
agcttccatcagtttgagaactacgttgccgttgcagatgacggaaacacagtgaatgtg
tgggactggaagcagggtactcggaagagccgcttctccaacggcaacccagagggatcc
aagatctcagatatgaagttcatcaacgaagatgatcaagcgctgttgatgacggcatca
tcagacggtgtaatccgtatttaccggaattacgataccaatgagaacatcgagctggca
tcggcttggcgcgctctgacgcatatggttccgtccaacgtcaactcgggcatggtgttc
gactggcaacaggtcaagggccaggtgctggtggccggggatgagagggtcattcgtatc
tggaatgccggtcatgaaatgtgtactcatgagattccggcacgatccggctcttgtgtg
acttccctcacttcagatcagatgacaggcaacatctttgttgctggatttggcgacgga
gcgatcagagtctttgacactcgtatgaagccacaggagaccatggttcggaaatggaag
gatgagaagagacaatgggtgcgatcggtgcacatgcaacgcggtgggcagagagagctg
ttgtcggccagccggaatggcaaggtccggttgtgggatatccgcatggaccaggcgctc
aaatcgttccagaccaccaaggacgtacttaggacggcaagcacgcacgaacacttgcct
gtctttgctgttggaacttcggcacaccttgtcaaggtctttgactttgatggccatgag
ttgactcggatcgagccttactccagcttcctccaggggcataagggtacacccatctct
gctactgcattccatcctcatcggatggttttgggttgcgctgctcgcggggactatcac
gtcaacctgttcgcttgtgggaacgagaaggttggccccttctaa

DBGET integrated database retrieval system