KEGG   Sordaria macrospora: SMAC_01314Help
Entry
SMAC_01314        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smp  Sordaria macrospora
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMAC_01314
   01230 Biosynthesis of amino acids
    SMAC_01314
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMAC_01314
   00030 Pentose phosphate pathway
    SMAC_01314
   00051 Fructose and mannose metabolism
    SMAC_01314
   00052 Galactose metabolism
    SMAC_01314
  Energy metabolism
   00680 Methane metabolism
    SMAC_01314
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SMAC_01314
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SMAC_01314
Protein phosphatases and associated proteins [BR:smp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SMAC_01314
Messenger RNA biogenesis [BR:smp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SMAC_01314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 792 aa AA seqDB search
MSPESTKMAPRKKIAIMTSGGDSPGMNAVVRACVRMAIHMGCDAYCVYEGYEGLVRGGDL
IKKMDWYDVRGWLSEGGTLIGTARCMAFYERAGRLTAAKNMILNGIDALIICGGDGSLTG
ADRFRAEWPSLLDELVSTGELTAEQIHAYKHLNIVGIVGSIDNDLSGTDATVGCYSALAR
VCMCVDLIEATASSHSRAFVVEVMGRHCGWLALMAGVATGADFIFIPEKPREDNWREEMC
NVVQEHRKLGKRKTIVIIAEGALDKFGNKISSEQVRDLLADKDGLALDTRITTLGHVQRG
GTAVAYDRMLATLQGVEAVKAVLEATPETKTCFIAITENKIVRKPLMEAVLDTKEVAKAI
ESQDFDGAMALRDAEFSEQYKSFMMTTAGQIDHETMLPEKERMKIGFINVGAPAGGMNAA
VRAGVAYCLSRGHEPIAIHNGFAGFARHHGDSPGAVRPFDWLEVDGWASKGGSEIGTNRE
LPSESGMETIANLIEQYQFDALFLIGGFEAFHAVEELRKAREQYPSLCIPMTLLPATISN
NVPGTEYSLGSDTCLNELVDYCDKIKQSASATRRRVFVIETQGGRSGYVATLAGLGVGAS
AVYLPEEGLSLDMLSEDVRHLKEVFAQDKGQSRAGRVILINEKASKVYNAKLIADILRDE
AHGRFESREGIPGHMQQGGVPSPMDRCRAVRLAIKCIQQLEKYGRNVHNRVKTDPMSASV
IGIKGASVVFTPIQKLAEEETDWPNRRPKAAFWLSMKEIVDILGGRPRHTLPEPDLTGVK
AKDVKRGLEPAQ
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccagaatccaccaagatggcgcccagaaagaagatcgccatcatgacttcgggc
ggcgactcccccggcatgaacgccgtcgtacgcgcctgtgtccgcatggccatccacatg
ggctgcgacgcctactgcgtctacgaaggctacgagggtttggttcggggcggtgatctc
ataaagaagatggactggtacgacgtgcgcggttggctctcagaaggtggtaccttgatc
ggtaccgctcgctgcatggctttctacgagcgcgctggtcgtcttactgccgccaagaac
atgatcctcaatggcatcgatgccctcatcatctgcggaggagacggctcccttaccggt
gccgacaggttccgtgctgagtggccttcgttgctggacgagctggtctctactggcgag
ctgacggccgagcaaattcacgcttacaagcacctcaacatcgttggtatcgtcggttcc
atcgacaacgatctgtctggtacagatgccaccgttggctgctactcggctttggcgaga
gtttgcatgtgtgtcgatctgatcgaggctaccgcttcttcccattcccgtgccttcgtc
gttgaggtcatgggcagacactgcggttggctagctttgatggcaggtgtcgcgacaggc
gcagattttatttttattcctgagaaacctagggaggacaactggagagaggagatgtgc
aacgttgttcaggaacatcgtaagcttggaaagcgcaagacgattgtcattatcgccgag
ggtgccctcgacaagttcggaaacaagatttcatccgagcaagtaagagacctcctcgcc
gacaaggatggcctcgccctcgatacccgtatcactactctcggccacgttcagcgcggt
ggtaccgccgtcgcatatgacaggatgcttgcgaccctccagggtgtcgaggccgtcaag
gctgtcctggaagccacccccgagaccaagacttgcttcatcgccattaccgaaaacaag
attgtcaggaagcccctgatggaagcggtgctggataccaaggaggtcgccaaggcgatt
gaaagccaggattttgacggagccatggctcttcgtgatgccgagttctcggagcagtac
aagtcgttcatgatgacaactgcaggccagattgatcacgagacgatgctgccagaaaag
gagcgcatgaaaattggctttatcaacgtcggggcccccgctggtggtatgaatgccgcc
gtccgagctggtgtggcgtactgcttgtctcgtggccacgagcccattgcgatccacaac
ggctttgcaggctttgcgcgccatcatggcgattccccaggcgcagtgcggcccttcgac
tggctcgaggtagatggctgggccagcaagggcggttctgagatcggtaccaaccgtgaa
ctcccgagtgagtctggtatggaaactatcgccaacctcatcgagcagtaccagttcgat
gccctgttcctaatcggcggcttcgaggctttccacgccgtcgaggaactgcgcaaggcc
agagagcagtacccatctctgtgcattcccatgacgctgctcccagcgaccatctccaac
aatgttcccggcactgagtattccctcggttccgacacctgccttaacgagcttgtcgac
tattgcgacaagatcaagcagtctgcgtctgccacccgcagacgtgtcttcgtcattgag
acacagggtggccgttccggttatgtcgcgacccttgccggtctcggcgttggtgcctcg
gctgtttaccttcccgaggaggggctcagcttggatatgctcagcgaagatgtccgtcat
ttgaaggaggtgttcgctcaagacaagggacagagcagagccggtcgcgttatcttgatc
aacgagaaggcctccaaggtctacaacgccaagctcattgccgatattctccgcgacgag
gcccatggccgtttcgaaagtcgtgagggtatccccggtcacatgcagcagggtggtgtt
ccctcgcccatggaccgttgccgtgctgtccgcctggccatcaagtgcattcagcagctt
gagaagtatggacgcaacgtgcacaaccgcgtcaagaccgatcctatgagcgctagcgtc
atcggtatcaagggagcgagtgtcgtcttcacaccgatccagaagttggcggaggaggag
accgactggcccaacagacgccccaaggctgccttctggcttagtatgaaggagattgtt
gacatccttggaggccgtccgcgacacaccttgcctgagcccgatcttacgggagtcaag
gctaaggatgtgaagcgtgggcttgagccggctcagtaa

DBGET integrated database retrieval system