KEGG   Sordaria macrospora: SMAC_01314Help
Entry
SMAC_01314        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smp  Sordaria macrospora
Pathway
smp00010  Glycolysis / Gluconeogenesis
smp00030  Pentose phosphate pathway
smp00051  Fructose and mannose metabolism
smp00052  Galactose metabolism
smp00680  Methane metabolism
smp01100  Metabolic pathways
smp01110  Biosynthesis of secondary metabolites
smp01130  Biosynthesis of antibiotics
smp01200  Carbon metabolism
smp01230  Biosynthesis of amino acids
smp03018  RNA degradation
Module
smp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMAC_01314
   00030 Pentose phosphate pathway
    SMAC_01314
   00051 Fructose and mannose metabolism
    SMAC_01314
   00052 Galactose metabolism
    SMAC_01314
  Energy metabolism
   00680 Methane metabolism
    SMAC_01314
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SMAC_01314
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SMAC_01314
Protein phosphatases and associated proteins [BR:smp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SMAC_01314
Messenger RNA biogenesis [BR:smp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SMAC_01314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK UVR
Motif
Other DBs
NCBI-GeneID: 10810111
NCBI-ProteinID: XP_003352480
Position
Unknown
AA seq 844 aa AA seqDB search
MPIFDRTFFSRPLSILYNPFPALFALFLLSASSLGIRLLLSSTTPRKVLPTKMSPESTKM
APRKKIAIMTSGGDSPGMNAVVRACVRMAIHMGCDAYCVYEGYEGLVRGGDLIKKMDWYD
VRGWLSEGGTLIGTARCMAFYERAGRLTAAKNMILNGIDALIICGGDGSLTGADRFRAEW
PSLLDELVSTGELTAEQIHAYKHLNIVGIVGSIDNDLSGTDATVGCYSALARVCMCVDLI
EATASSHSRAFVVEVMGRHCGWLALMAGVATGADFIFIPEKPREDNWREEMCNVVQEHRK
LGKRKTIVIIAEGALDKFGNKISSEQVRDLLADKDGLALDTRITTLGHVQRGGTAVAYDR
MLATLQGVEAVKAVLEATPETKTCFIAITENKIVRKPLMEAVLDTKEVAKAIESQDFDGA
MALRDAEFSEQYKSFMMTTAGQIDHETMLPEKERMKIGFINVGAPAGGMNAAVRAGVAYC
LSRGHEPIAIHNGFAGFARHHGDSPGAVRPFDWLEVDGWASKGGSEIGTNRELPSESGME
TIANLIEQYQFDALFLIGGFEAFHAVEELRKAREQYPSLCIPMTLLPATISNNVPGTEYS
LGSDTCLNELVDYCDKIKQSASATRRRVFVIETQGGRSGYVATLAGLGVGASAVYLPEEG
LSLDMLSEDVRHLKEVFAQDKGQSRAGRVILINEKASKVYNAKLIADILRDEAHGRFESR
EGIPGHMQQGGVPSPMDRCRAVRLAIKCIQQLEKYGRNVHNRVKTDPMSASVIGIKGASV
VFTPIQKLAEEETDWPNRRPKAAFWLSMKEIVDILGGRPRHTLPEPDLTGVKAKDVKRGL
EPAQ
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgcccatttttgatcgaaccttcttctctcgaccattatctatcctctataacccattt
ccggcgctctttgccctcttcctcctctcggcctcctcgctaggcatccgactcctactg
agctcgaccactcctcgaaaagtactaccaacgaaaatgtcgccagaatccaccaagatg
gcgcccagaaagaagatcgccatcatgacttcgggcggcgactcccccggcatgaacgcc
gtcgtacgcgcctgtgtccgcatggccatccacatgggctgcgacgcctactgcgtctac
gaaggctacgagggtttggttcggggcggtgatctcataaagaagatggactggtacgac
gtgcgcggttggctctcagaaggtggtaccttgatcggtaccgctcgctgcatggctttc
tacgagcgcgctggtcgtcttactgccgccaagaacatgatcctcaatggcatcgatgcc
ctcatcatctgcggaggagacggctcccttaccggtgccgacaggttccgtgctgagtgg
ccttcgttgctggacgagctggtctctactggcgagctgacggccgagcaaattcacgct
tacaagcacctcaacatcgttggtatcgtcggttccatcgacaacgatctgtctggtaca
gatgccaccgttggctgctactcggctttggcgagagtttgcatgtgtgtcgatctgatc
gaggctaccgcttcttcccattcccgtgccttcgtcgttgaggtcatgggcagacactgc
ggttggctagctttgatggcaggtgtcgcgacaggcgcagattttatttttattcctgag
aaacctagggaggacaactggagagaggagatgtgcaacgttgttcaggaacatcgtaag
cttggaaagcgcaagacgattgtcattatcgccgagggtgccctcgacaagttcggaaac
aagatttcatccgagcaagtaagagacctcctcgccgacaaggatggcctcgccctcgat
acccgtatcactactctcggccacgttcagcgcggtggtaccgccgtcgcatatgacagg
atgcttgcgaccctccagggtgtcgaggccgtcaaggctgtcctggaagccacccccgag
accaagacttgcttcatcgccattaccgaaaacaagattgtcaggaagcccctgatggaa
gcggtgctggataccaaggaggtcgccaaggcgattgaaagccaggattttgacggagcc
atggctcttcgtgatgccgagttctcggagcagtacaagtcgttcatgatgacaactgca
ggccagattgatcacgagacgatgctgccagaaaaggagcgcatgaaaattggctttatc
aacgtcggggcccccgctggtggtatgaatgccgccgtccgagctggtgtggcgtactgc
ttgtctcgtggccacgagcccattgcgatccacaacggctttgcaggctttgcgcgccat
catggcgattccccaggcgcagtgcggcccttcgactggctcgaggtagatggctgggcc
agcaagggcggttctgagatcggtaccaaccgtgaactcccgagtgagtctggtatggaa
actatcgccaacctcatcgagcagtaccagttcgatgccctgttcctaatcggcggcttc
gaggctttccacgccgtcgaggaactgcgcaaggccagagagcagtacccatctctgtgc
attcccatgacgctgctcccagcgaccatctccaacaatgttcccggcactgagtattcc
ctcggttccgacacctgccttaacgagcttgtcgactattgcgacaagatcaagcagtct
gcgtctgccacccgcagacgtgtcttcgtcattgagacacagggtggccgttccggttat
gtcgcgacccttgccggtctcggcgttggtgcctcggctgtttaccttcccgaggagggg
ctcagcttggatatgctcagcgaagatgtccgtcatttgaaggaggtgttcgctcaagac
aagggacagagcagagccggtcgcgttatcttgatcaacgagaaggcctccaaggtctac
aacgccaagctcattgccgatattctccgcgacgaggcccatggccgtttcgaaagtcgt
gagggtatccccggtcacatgcagcagggtggtgttccctcgcccatggaccgttgccgt
gctgtccgcctggccatcaagtgcattcagcagcttgagaagtatggacgcaacgtgcac
aaccgcgtcaagaccgatcctatgagcgctagcgtcatcggtatcaagggagcgagtgtc
gtcttcacaccgatccagaagttggcggaggaggagaccgactggcccaacagacgcccc
aaggctgccttctggcttagtatgaaggagattgttgacatccttggaggccgtccgcga
cacaccttgcctgagcccgatcttacgggagtcaaggctaaggatgtgaagcgtgggctt
gagccggctcagtaa

DBGET integrated database retrieval system