KEGG   Sordaria macrospora: SMAC_01361Help
Entry
SMAC_01361        CDS       T01610                                 

Definition
(RefSeq) hypothetical protein
Organism
smp  Sordaria macrospora
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 416 aa AA seqDB search
MAATVASSHSFGGGLHPLQAKGILAAAQQRQQQQQAQSQPQLHPCMLSQHNSYQNDQRRH
DPSQTQQNNNTGGGFEMATRKPQLSDFHRIRTLGTGTFARVVLVRPANGTEIDRQKVYAL
KILRKTEVIRLKQIDHVRHERQILKDVTGHPFITSLQASFADRDFLYLLLDYIPGGELFT
YLRKYRRFDEEMARFYAAEIVLVLEYLHEKQGGIAYRDMKPENLLLDADGHIKLVDFGFA
KRLGYKDDEHPVETYTLCGTPEYLAPEVIQNKGHTTAVDWWALGILIYEFLTGYPPFYHN
NPLEIYRQIVEKPVLFPATPEISEEAKDIIRSFCTVDRTMRLGNMSGGAARVKAHPWFKG
VDWEAVEQKRHKGPIIPHLSHPGDASCFDVYPEQDVNNEAYTDEMFEKYEKYFEDF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccgtcgcctcgtcacactcatttggcggtgggctacacccactgcaggca
aaggggatacttgcagccgcccagcagcgccaacagcagcagcaggcgcagtcgcaaccc
caacttcatccctgcatgctttcgcagcacaactcttaccagaacgaccaacgccgacat
gacccatcacaaacgcaacagaataataatactggcggtggattcgagatggccacgcgc
aagccccagctaagcgactttcatcgcataaggacattaggaaccggcacctttgcccgt
gtggtactcgtccgaccagccaatggcaccgagattgaccgccaaaaggtttacgcattg
aagattctaagaaagaccgaagtgatcagactaaaacagatcgaccatgtgcggcacgag
cgacagatcctcaaggatgtaacgggccacccgttcatcaccagtctccaagcctccttt
gccgaccgcgacttcctctaccttttgctcgactacatccccggcggcgagctgttcaca
tatttgcgaaaataccgacggttcgacgaggagatggcgcgcttctacgcggccgagatc
gtgctcgtgctcgagtacctccacgaaaagcagggcggaatagcttaccgggatatgaag
cctgagaacctgctgctggatgcggacgggcacatcaagctggtcgactttggttttgcc
aagcggttggggtacaaggacgatgagcacccggtcgagacctacaccctttgtggcact
ccagagtaccttgcgcccgaggtcatccagaacaagggccacacgacagcggtagactgg
tgggcgttggggattctgatatacgagttcctaacgggctatccgcccttctaccacaac
aaccctctagagatttacagacaaatcgtagaaaagcccgtcctattccccgccacaccc
gaaatcagcgaagaagccaaggacatcatccggtctttctgcacggtcgaccgaactatg
cgattaggcaacatgagcggcggcgcggcaagggtgaaggcgcacccgtggtttaagggc
gtcgactgggaggccgtggagcaaaaacggcacaagggtcccatcatcccccacctcagt
caccccggcgacgcctcgtgcttcgacgtgtatccagagcaggacgtcaacaacgaggcg
tacacggacgagatgtttgagaagtatgagaagtacttcgaggacttttag

DBGET integrated database retrieval system