KEGG   Sordaria macrospora: SMAC_01445Help
Entry
SMAC_01445        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
smp  Sordaria macrospora
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 544 aa AA seqDB search
MATEIVHPRSKPNRGPGLPDFPAPLESSRFPRIGKLQLLNHFPPAPHGPTTSRLVQNGHP
ACALPPPFIVQGNVGGCLSSKTLPRMPARNLYTRNLTHQCFLGIDIKPFVVHINVEIAAA
IFLVFSPGPSPRILVPQITILQVKMKATILASTFAAGALAQSGAWGQCGGNGWSGATTCV
SGYTCSYVNDWYSQCLPGAAAPTTTARTTTARTTTARTTTLVTSTKTAPPSTTTTATASG
KFKWFGVNEAGGEFGDGIFPGRWGTEFIFPDVNTIQTLRSQGYNIFRVGFSMERLVPNTL
TSSFDNGYLTNLTQVVNSVTNSGAYVVLDPHNYGRYYGNIITDTNAFKTFWQNVASKFVS
NSKVIFDTNNEYHTMDQTLVLNLNQAAINGIRAAGATSQYIFVEGNQWSGAWSWNVTNTN
MVALTDPQNKIVYEMHQYLDSDSSGTSTTCVSTEIGVQRIVGATAWLRANGKKGVLGEFA
GGANSVCKAAVTGLLDHLKANSDVWEGALWWAAGPWWGDYMYSFEPPSGTGYTYYNSLLK
TYTP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggctacggagattgtccatccgcggtcgaaaccgaaccgtggccccggcctccccgac
ttccccgcgccgctggaatcgtcgagattcccaagaatcgggaagctccagctgttaaac
catttcccaccagcgcctcacggaccgacaacctcacgcttagtccagaatgggcatccg
gcctgcgctctaccgccccctttcattgttcaaggcaacgtcggcggatgtctctcctcc
aagacactccccaggatgccggcccgcaacctctacacgcgcaacctgacccaccaatgc
ttcctcggcatcgacatcaagcctttcgttgtgcatataaatgtcgagatcgccgccgcc
atcttcttggttttctctcccggaccatcgccaaggattctagttcctcagatcaccatc
ctccaagtcaagatgaaggctacgattcttgccagcaccttcgccgctggtgccctcgcc
cagagcggtgcttggggccagtgcggcggtaacggttggtccggcgctaccacctgcgtc
tccggatacacctgctcctacgtgaacgactggtacagccagtgccttcctggtgccgct
gctcccaccaccactgcccgcaccaccactgcccgcaccaccactgcccgcaccaccacc
ctcgtcacctctaccaagactgcccctccttccactaccaccactgctactgcctccggc
aagttcaagtggttcggcgtcaacgaggccggtggtgagttcggcgatggtatcttcccc
ggaagatggggcactgagttcatcttccccgacgtcaacaccatccagactctccgcagc
cagggttacaacatcttccgtgttggcttctccatggagcgtcttgtccccaacaccctg
acttcgtctttcgacaacggctatcttaccaacctcacccaggttgtcaactctgtcacc
aactccggtgcctatgtcgttctcgatccccataattatggccgctactatggcaacatc
atcactgataccaacgccttcaagactttctggcagaacgttgcttccaagttcgtctcc
aactccaaggtcatcttcgataccaacaacgagtaccacaccatggaccagacccttgtc
ctcaacctcaaccaggccgccatcaacggtatccgtgccgccggtgccacttcccagtac
attttcgtcgagggtaaccagtggtctggcgcctggtcctggaacgtgaccaacaccaac
atggtcgcccttaccgaccctcagaacaagatcgtctacgagatgcaccagtatcttgac
tctgacagctccggtaccagcaccacctgcgtttccactgagattggtgttcagcgtatc
gttggtgccaccgcctggctccgcgccaacggaaagaagggtgtcctcggcgagttcgcc
ggtggtgccaactcggtctgcaaggctgctgtcaccggcctccttgatcacctcaaggct
aactctgacgtctgggagggtgctctctggtgggctgccggcccctggtggggtgactac
atgtacagctttgagcctccttctggcactggctatacctactacaacagcctccttaag
acctataccccttaa

DBGET integrated database retrieval system