KEGG   Sordaria macrospora: SMAC_01494Help
Entry
SMAC_01494        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
smp  Sordaria macrospora
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:smp04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 534 aa AA seqDB search
MHHPTLCALAVGILSALPGAQAGLYTKKSPVLQVDGKDYDRLIAKSNQTTIVEFYAPWCG
HCQNLKPAYEKAAKNLEGLAKVAAVNCDDDANKPFCGSMGVKGFPTLKIVRPGKKAGSKP
VVEDYQGQRTASAIVDAVVSRINNHVVKVEDKNLDNFLSDKNETAKALLFTDKGTTSALL
KSVAIDFLDVITVGQVRNTQSKAVSTFGVDKFPTLILLPGGDAPGLVYDGEIKKAAMVKF
LSQAGQPNPDPAPAKAKNGGKKDSKKTDSSKKAASSSSTKSKSSETSTFSSSETAAPTQE
APVIINTALPIPTLNTPEKLTKECLTSKSNTCVLAFVSSSSGDKSQKALANLAELAFKHA
HSNRKLFPFYEVPLASNPGGSALLASLGLDVSSETSDDIQIIAINARRGWWRHYDSVSIS
DDFSGHDKLEAWIDAIRMGEGTKKKVPEGVVVDVSQVKEESESKAEKAKPEEAVAEEETT
PEATKAVPTADGEEAPVTPEASEATAAAEGEEEESTAPVDPTPEPETAAAHDEL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaccccaccctctgcgctctggcagttggtatcctgtctgcgctccccggagcc
caggccggtctatataccaaaaagtctccagtcttgcaggtcgatggaaaggattacgat
aggttgattgccaagagcaaccagacgactatcgttgaattctacgccccctggtgcggc
cactgccagaacctcaagcctgcctacgaaaaagccgccaagaacctcgaagggctagcc
aaggtcgccgccgtcaactgcgatgatgacgccaacaagcccttctgcgggagcatgggt
gtcaaagggttccctaccctcaagatcgtccgccctggtaagaaggccggcagcaagcct
gtggtggaggactaccagggccagcgcacggccagcgccatcgtcgacgccgtggtctcg
cgcatcaacaaccacgtcgtgaaagtggaggacaagaacctcgacaatttcctgagcgac
aagaacgagacggccaaggcgctgctcttcactgacaagggcaccacctcggccttgctc
aagagcgtggcgattgacttcctcgatgtcatcacggttggtcaggtgcggaacacccag
tccaaggccgtctcaactttcggtgtcgacaagttccctactctgatcttgctgcccggc
ggtgatgcccctggtctcgtgtacgacggcgagatcaagaaggccgccatggtcaagttc
ctttcccaggcgggccagcctaacccggatccagcaccggccaaggccaagaatggagga
aagaaggactccaagaagacggactctagcaagaaggccgcatcctcctcttcaactaag
tccaagtcgtccgagacatcaacattctcctccagcgagaccgccgccccaacgcaagaa
gcccccgtaatcatcaacaccgccctgcccatccccacactcaacaccccggagaagcta
accaaggaatgcctcacctcgaaatccaacacgtgcgtcctcgcctttgtttcttctagc
agcggcgacaagtcccaaaaggcccttgcaaacctcgccgaactagcattcaaacacgcc
cactccaaccgcaagctcttccccttttacgaagtgcccctagctagcaaccccggcggt
tctgcccttctcgcctctctcggcctcgatgtctcctctgaaacctctgatgatattcag
attatcgccatcaacgcccgccgcggctggtggcggcactacgactccgtttctatctct
gacgacttctcaggacacgataagctggaggcgtggattgatgcgattaggatgggcgag
gggacgaagaagaaggtgcctgagggtgtggttgttgatgtctcgcaggtcaaggaggag
agtgagagtaaggcagaaaaggcaaagcctgaggaggctgttgccgaggaggagacgacg
ccggaggctaccaaggctgttcctactgctgatggtgaggaggcgccggttacgcctgag
gcgagcgaggcgactgctgcggcggagggtgaagaggaggagtcaactgcgccggttgat
cctacgcctgagccggagactgcggcggctcatgatgagctttag

DBGET integrated database retrieval system