KEGG   Sordaria macrospora: SMAC_01662Help
Entry
SMAC_01662        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
smp  Sordaria macrospora
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smp00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 477 aa AA seqDB search
MPPKGKMTDSIDLPASSKPAAPTVRTAYIALGSNLGDRIGWVEKACKEMDARGIKVKRTS
CLWETEPMYILDQDRFVNGACEVETTLEPLELLDALQDIENSLGRKKIIDKGPRNIDLDI
LLYENLAFDHERLKIPHIGIPEREFVLRPLAELIPDKPLDHTRPWTLTRDLLDALPPSPT
PITTMTPLSSHGHPPIQALNPSRKTHIMAILNMTPDSFSDGGMHGSSTLESTIQSFLDAG
ATMIDVGGQSTAPRTPQVSSSEEIGRVVPAIRMIREKFSSRDVLISVDTYRASVAEAAVA
AGADIVNDVSGGSMDPDMLPTVARLGSTICLMHMRGTPANMSSLNEYPESEGGLIGGIAR
ELVGRVAAAEAAGIRRWRIVLDPGLGFAKVGPQNVDVLRHLEELRTWPGLQGLPWLVGSS
RKSFIGQVTGVPTPKERIWGTAATVAAAVQGGADVVRVHDVKEMAQVVAMADAIWRY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaaggcaaaatgacggactcaattgacctcccggcgtcttccaagcccgcc
gctcccacggtgcgcactgcttacatcgccctgggcagcaacctcggcgacaggatagga
tgggtcgaaaaggcttgcaaggagatggatgcccgcggtatcaaggttaagcggaccagc
tgtctgtgggagacggagcccatgtacatcttagaccaagatagatttgtcaatggagca
tgcgaggttgaaaccactctagaaccccttgagcttctagacgcacttcaagatattgaa
aactcccttggtcgcaagaagattattgacaagggtccccgtaacattgacctcgacatt
cttctctacgaaaaccttgcgttcgaccatgaacgtctcaagatccctcacattggcatt
cccgagcgcgaattcgtcctccggcccttagcagaactcatccccgacaaacccctcgac
cacacccgtccctggaccctcacccgtgacctcctcgacgccctccccccttccccaact
cccatcaccaccatgaccccgctctcctcccacggccacccgcccatccaagccctcaac
ccctctcgcaagacacacataatggccatcctcaacatgacccccgactccttttccgac
ggcggcatgcacggctcctcaaccctcgaatccaccatccaatccttcctcgacgccggc
gccaccatgatcgacgtaggcgggcagtccaccgcccctcgcaccccccaagtttcctcc
tccgaagagatcggccgcgtcgtgcccgccatcaggatgatccgcgaaaagttcagcagt
cgcgacgtgctgatcagcgtcgacacgtaccgcgcttccgtggcggaggcggcggtggcg
gccggtgcggatatcgttaatgatgtttcgggcggcagcatggatccggatatgttgcct
actgttgccaggctgggaagcaccatttgtttgatgcacatgcgcgggacgccggcgaat
atgtcttccctcaacgagtaccctgagtccgaaggcgggttgatcgggggaattgcgagg
gagctggtggggagggtggcggctgctgaggcggcggggattagacgctggaggatcgtg
ttggaccccgggttgggctttgcgaaggtcggaccgcaaaatgtcgatgttttgaggcac
ttggaggagttgaggacgtggcctggattgcaggggttgccgtggctggtgggatcgagt
aggaagagctttattgggcaggtgacgggggtgccgacgcccaaggagaggatttggggc
acggcggcgacggtcgcggctgcggtgcagggtggagcagatgtggtgagggtgcatgat
gtcaaggagatggcgcaggtggttgctatggctgatgctatttggaggtattag

DBGET integrated database retrieval system