KEGG   Sordaria macrospora: SMAC_01807Help
Entry
SMAC_01807        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smp  Sordaria macrospora
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SMAC_01807
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SMAC_01807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MATTTPRITVLGSLNIDLVAYVSHHPLPGETMTANSVAVSPGGKGANQAVACAKLSRSHS
SPEESETAHITMLGTVGTDSYGTLLRENLSKHGVDVSGVRVLDTPGSKTGMAMIVVDEPT
GQNRIILSPEANHFLQPEHVSSVSNLAAEGQEKPDLLIMQLEIPVPTVLQALKTAKQNGV
QVLLNPAPAVPLPDEAFQGLAHLVVNETEASILSGLEESVLDTEEGLEKVGQVFLGKGVK
TVIVTLGGRGVFFMTGDNDGEKKKGLVQAEKAKVVDTTAAGDTFVGMYALEVVTAAKKGE
QFDIEAAVRKANKAAAKTVERVGAQDSIPWRDELL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggccaccactaccccaagaatcacagtcctaggctccctaaacatcgacctagtagcc
tacgtctcccaccaccctttgccaggcgagacaatgaccgccaactcggtcgccgtctcc
cccggcggcaagggcgccaaccaagccgttgcatgcgcgaaactctctcgctcccactcc
tcgccggaagagagcgagacggctcacataacaatgctaggcaccgtaggcaccgactcc
tacggcaccctcctccgcgaaaacctttccaagcacggcgtcgacgtctccggcgttcgc
gtgctcgacactcccggctccaagacaggaatggccatgatcgttgtcgatgagcccact
ggccaaaacagaatcattctcagtcccgaagcgaaccatttcttgcagccggagcatgtt
tcttccgtgtccaacctggcggccgagggccaggaaaagccggatttgttgatcatgcag
ttggaaatccccgtgccgacggtcctccaggcgctgaagactgcgaagcaaaatggtgtg
caggttctgttgaacccggcgccggcggtgccgttgcctgatgaggcctttcaggggctg
gcgcatttggttgttaacgagactgaagcctccatcttgtctggcctggaggagagcgtg
ctggataccgaggagggattggaaaaagttggacaggtcttcctgggcaagggggttaag
acggtgattgttacgcttggtggtcggggcgttttcttcatgactggtgataacgacgga
gaaaagaagaagggattggtgcaagcggaaaaggccaaggtggtggataccacggctgct
ggcgacacgtttgtgggcatgtatgctttggaggtggtgacggctgctaagaaaggggag
cagtttgatatcgaggcggcggttaggaaggcgaataaggcggcggcgaagacggtggag
agggtgggcgcgcaggattcgattccttggagggatgagttgttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system