KEGG   Sordaria macrospora: SMAC_02127Help
Entry
SMAC_02127        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
smp  Sordaria macrospora
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SMAC_02127
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    SMAC_02127
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     SMAC_02127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 295 aa AA seqDB search
MARLSAARYGKDNVRVYKVHKDEKTGQQSVTEMTVCCLLEGQIETSYTEADNSVVVATDS
IKNTIYIKAKEHPVNPPELYASILGQHFLDKYAHITAAHIDITVHRWTRMVIDGQPHPHS
FLRDGQETRNVEATVTRDGIAIKSGIVGLQVLKSTGSAFHGFVRDEFTTLKETWDRILST
DVDAGWTWQKFANLAAVQEGVERFDAAWEAARNITLKTFAEDESASVQNTMYKMCEQILD
AVPEADKTNYSLPNKHYFEVDLSWHKGLQNTGKDAEVFAPQSGPNGLIKCEVSRS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcctttctgctgctcgctacggcaaggacaatgtccgtgtctacaaggtccac
aaggatgagaagaccggccagcagtccgtcaccgagatgaccgtctgctgccttctcgag
ggccagatcgagacttcctacaccgaggccgacaacagcgtggttgtcgctaccgactcc
atcaagaacaccatctacatcaaggccaaggagcaccccgtcaaccctcccgagctgtac
gccagcatcctgggccagcacttcctcgacaaatacgcccacatcacggccgcccacatc
gacatcaccgtccaccgctggacgcgcatggtcatcgacggccagccccacccccacagc
ttcctgcgtgacggccaggagacccgcaacgtcgaggccacggtcacgcgggacggcatc
gccatcaagagcggcatcgtcggcctccaggtgctcaagagcaccggctccgccttccac
ggcttcgtccgtgacgagtttaccaccctcaaggagacgtgggaccgcatcctctcgacc
gacgtggacgccggctggacctggcagaagttcgccaacctggcggccgtgcaggagggc
gtcgagcgcttcgacgccgcgtgggaggccgcccgcaacatcacgctcaagacctttgcc
gaggacgagtcggcgtcggtccaaaacaccatgtacaagatgtgcgagcagatcttggat
gcggtgcccgaggccgacaagaccaactattcgctgcccaacaagcactactttgaagtt
gacctcagctggcacaagggcctccagaacaccggcaaggacgccgaggtgtttgctccc
cagtctggtcccaacggtctcatcaagtgcgaggtctctcgctcgtaa

DBGET integrated database retrieval system