KEGG   Sordaria macrospora: SMAC_02127Help
Entry
SMAC_02127        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
smp  Sordaria macrospora
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:smp00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:smp00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 295 aa AA seqDB search
MARLSAARYGKDNVRVYKVHKDEKTGQQSVTEMTVCCLLEGQIETSYTEADNSVVVATDS
IKNTIYIKAKEHPVNPPELYASILGQHFLDKYAHITAAHIDITVHRWTRMVIDGQPHPHS
FLRDGQETRNVEATVTRDGIAIKSGIVGLQVLKSTGSAFHGFVRDEFTTLKETWDRILST
DVDAGWTWQKFANLAAVQEGVERFDAAWEAARNITLKTFAEDESASVQNTMYKMCEQILD
AVPEADKTNYSLPNKHYFEVDLSWHKGLQNTGKDAEVFAPQSGPNGLIKCEVSRS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcctttctgctgctcgctacggcaaggacaatgtccgtgtctacaaggtccac
aaggatgagaagaccggccagcagtccgtcaccgagatgaccgtctgctgccttctcgag
ggccagatcgagacttcctacaccgaggccgacaacagcgtggttgtcgctaccgactcc
atcaagaacaccatctacatcaaggccaaggagcaccccgtcaaccctcccgagctgtac
gccagcatcctgggccagcacttcctcgacaaatacgcccacatcacggccgcccacatc
gacatcaccgtccaccgctggacgcgcatggtcatcgacggccagccccacccccacagc
ttcctgcgtgacggccaggagacccgcaacgtcgaggccacggtcacgcgggacggcatc
gccatcaagagcggcatcgtcggcctccaggtgctcaagagcaccggctccgccttccac
ggcttcgtccgtgacgagtttaccaccctcaaggagacgtgggaccgcatcctctcgacc
gacgtggacgccggctggacctggcagaagttcgccaacctggcggccgtgcaggagggc
gtcgagcgcttcgacgccgcgtgggaggccgcccgcaacatcacgctcaagacctttgcc
gaggacgagtcggcgtcggtccaaaacaccatgtacaagatgtgcgagcagatcttggat
gcggtgcccgaggccgacaagaccaactattcgctgcccaacaagcactactttgaagtt
gacctcagctggcacaagggcctccagaacaccggcaaggacgccgaggtgtttgctccc
cagtctggtcccaacggtctcatcaagtgcgaggtctctcgctcgtaa

DBGET integrated database retrieval system