KEGG   Sordaria macrospora: SMAC_02229Help
Entry
SMAC_02229        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
smp  Sordaria macrospora
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smp01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:smp00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 743 aa AA seqDB search
MSVIDHSPHDSDPSPLVETASNLILIDNYDSFTWNVYQYLVLEGAKVTVFRNDQITIDDL
IAKNPTQLVISPGPGHPGTDSGISRDAIKHFAGKIPIFGVCMGQQCIFDVYGGDVSFAGE
ILHGKTSPLCHDGKGAYAGLPQDLPVTRYHSLAGTHVTLPECLEVTSWIAKEDGSKGVIM
GVRHKEYTIEGVQFHPESILSAEGRGMFRNFLHMQGGTWAENERLQKETRAKAARTKSGT
STPKKSNILQKIYAHRKAAVDAQKQIPSQRLSDLQAAYNLSLAPPQISLVDRLRNSPFDV
ALCAEIKRASPSKGVFALDIDALRKLAKWFKGSIDDLRAVRQVLNGMPNRPAVLRKEFIF
DEYQILEARLAGADTVLLIVKMLDYELLERLYKYSLSLGMEPLVEVQNTEEMATAIKLGA
KVIGVNNRNLESFEVDLGTTGRLRSMVPNDTFLCALSGINTHQDVLDCKRDGVNGILVGE
AIMRAPDATQFIRELCAGLTGPVPKSAAEPLLVKICGTRSAEAATEAIKAGADLVGMILV
PGTKRCVDHETALSISQAVHMSKKTGSTEVSSQASKSARDFFNINAEVIRKRGPLLVGVF
MNQPIEEVLEKQRLYDLDIVQLHGDEPLEWANFIPVPVIRKFKPGQVGLATRGFHAVPLL
DSGAGSGEMLNLESVKKELEKDEQVTVLLAGGLGPSNVAETVKSLGALAERVIGVDVSSG
VEEGGKQSLEKIREFVKAAKSVR
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcatcgaccattccccccacgattccgatccttcacctctggtggaaacagcc
tccaacctcatcctcatcgacaactatgattccttcacctggaatgtctaccaatatctc
gtcctcgagggcgccaaggtgaccgtcttccgcaacgaccagatcaccatcgacgacctc
atcgcaaagaaccctacccagctcgtcatcagccctggtcccggtcatcccggtaccgac
tccggtatctcgcgcgatgccatcaagcactttgccggcaagatccccatcttcggtgtg
tgcatgggtcagcagtgcatcttcgatgtctacggtggcgatgtgagcttcgccggtgag
attcttcacggaaagacctctcctctttgccacgacggaaagggcgcatatgccggtctt
cctcaggatctgccagtgacgagataccactctcttgccggtactcatgtcaccctcccc
gagtgcttggaggtgacctcttggattgcaaaggaggatggttccaagggcgtcatcatg
ggtgttcgtcacaaggagtacaccattgagggtgttcagttccacccggagagcattctg
tccgctgagggtcgtggcatgttccggaatttccttcacatgcagggaggcacctgggcg
gagaacgagagactgcaaaaggagacccgggcaaaggccgcccgcacaaagtccggcact
tccacgcccaagaagagcaacatccttcaaaagatctatgcccaccgcaaggctgccgtg
gatgctcagaagcagatcccttcccagagactttccgacctccaagctgcttacaacctg
agccttgctcctcctcagatctctcttgtcgaccgtcttcgcaactccccctttgatgtc
gctctttgcgccgagatcaagagagcatctccctccaagggcgtctttgcgcttgacatt
gacgcccttcgcaagctcgcaaagtggttcaagggcagcatcgacgacctccgtgctgtc
cgccaggtcctcaacggcatgcctaaccggcctgctgtcctccgcaaagagttcatcttc
gacgagtaccagatcctcgaagccagactcgccggtgctgacactgtccttcttatcgtc
aagatgctcgactatgagcttctcgagcgcctctacaagtactccctttctctcggtatg
gagcccctagtcgaggtccagaacaccgaggagatggccacggctatcaagctcggcgcc
aaggttatcggcgtcaacaaccgcaacctcgagagcttcgaagtcgatctcggcaccacc
ggccgtctccgcagcatggtgcccaacgataccttcctctgcgctctcagcggcatcaac
acccaccaggatgttctcgactgcaagcgtgacggcgtcaacggcatcctcgtcggcgag
gccatcatgcgtgctcccgacgccacccagttcatccgtgagctctgcgccggcctgacc
ggccccgtgcccaagtctgccgctgagccgctcctcgtcaagatctgcggcacccgttcc
gctgaggccgccacggaagccatcaaggccggtgccgatctcgtcggcatgatcctcgta
ccgggcaccaagcgctgcgtcgaccatgaaaccgccctctccatctcccaggctgtgcac
atgagcaagaagaccggatccaccgaggtctcctcgcaagcttccaagtctgcaagggac
tttttcaatattaacgccgaggtcatccgcaagcggggacccctgttggtcggtgttttt
atgaatcagcccattgaggaggttctcgagaagcagcgtctctatgatctcgatatcgtc
cagctccacggtgatgagccgctcgagtgggccaactttatcccagtgcccgtcatccgc
aagttcaagcccggtcaggtcggtcttgccactcgcgggttccatgccgtgccgctgctg
gattcgggcgccggatctggcgagatgctgaacttggaatctgtcaagaaggagttggag
aaggatgagcaggttaccgtcctgcttgcgggtggactggggcctagcaatgtcgctgag
acggtcaagtctctgggggctctggccgagagggtgattggtgtggatgtcagcagtggt
gttgaggagggaggcaagcaaagcttggagaagattagggagtttgttaaggctgccaag
tccgtcaggtaa

DBGET integrated database retrieval system