KEGG   Sordaria macrospora: SMAC_02442Help
Entry
SMAC_02442        CDS       T01610                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smp  Sordaria macrospora
Pathway
smp00010  Glycolysis / Gluconeogenesis
smp00071  Fatty acid degradation
smp00350  Tyrosine metabolism
smp01100  Metabolic pathways
smp01110  Biosynthesis of secondary metabolites
smp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMAC_02442
  Lipid metabolism
   00071 Fatty acid degradation
    SMAC_02442
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMAC_02442
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMAC_02442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 DUF2226 adh_short AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 10808330
NCBI-ProteinID: XP_003350771
UniProt: F7VPK8
AA seq 353 aa AA seqDB search
MTNFEIPEQQWAQVVEKKGGPVVFKQIPVQKPGPDEVLINVKYSGVCHTDLHAMKGDWPL
DTKLPLVGGHEGAGIVVAKGELVTEVEVGDRAGIKWLNGSCLACSFCMQADEPLCPHALL
SGYTVDGSFQQYAIAKAAHVAKIPKECDLEAIAPVLCAGITVYKGLKESGARPGQWVAIV
GAGGGLGSMAIQYANAMGLHAIAIDGGEEKGKNCRELGAKAYVDFTTSKDLVADVKAATP
EGMGPHAVILLAVSERPFHQAVEYVRPRGTIICIGLPAGAYFKAPVFDTVIRMITIKGSY
VGNRQDTQEAIDFFARGLVKVPIKTVGLSKLQEVYDLMEEGKIVGRYVVDTSK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacttcgagatcccagagcagcaatgggcccaggtagtcgagaagaagggcggt
cccgtcgtcttcaagcagatccccgtccagaagcccggccccgatgaggtcctcatcaac
gtcaagtactctggtgtctgccataccgatctccatgccatgaagggtgattggcccctc
gataccaagcttcccctcgtcggtggccacgaaggtgccggtatcgtcgtagccaagggt
gagcttgtcaccgaggttgaggtcggcgaccgcgccggtatcaagtggctcaacggctcc
tgcctggcctgctccttctgcatgcaggccgacgagcccctgtgcccccacgccctccta
tccggctacaccgtcgacggttccttccagcagtacgccatcgccaaggccgcccatgtc
gccaagatccccaaggagtgcgacctcgaggccatcgcgcccgtgctctgcgccggtatc
accgtctacaagggtctcaaggagtccggtgctcggcccggtcagtgggttgccatcgtc
ggcgccggcggcggtctcggcagcatggctattcagtacgccaacgccatgggcctgcac
gccatcgccatcgacggcggcgaggagaagggcaagaactgccgcgagcttggcgccaag
gcttacgtcgacttcaccacctccaaggaccttgtcgcggacgtcaaggccgccacccct
gagggcatgggtccccacgccgtcattttgttggctgtctccgagaggccgttccaccag
gccgtcgagtacgtccggccccgtggaaccatcatctgcatcggtctccccgctggcgcg
tacttcaaggcccctgtctttgataccgtcatccgcatgatcaccatcaagggctcgtat
gtcggtaacagacaggatacccaggaggccatcgacttctttgcccgcggccttgtcaag
gttcccatcaagactgtcggccttagcaagttgcaggaggtctacgacttgatggaggag
ggcaagattgtcggcagatatgttgtcgacaccagcaaatag

DBGET integrated database retrieval system