KEGG   Sordaria macrospora: SMAC_02617Help
Entry
SMAC_02617        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13278  60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SMAC_02617
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     SMAC_02617
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     SMAC_02617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asparaginase Ank_2 Ank_4 Ank Ank_3 Ank_5
Motif
Other DBs
NCBI-GeneID: 10809811
NCBI-ProteinID: XP_003352182
UniProt: F7VWZ7
Position
Unknown
AA seq 596 aa AA seqDB search
MGQVTFMEGKNPEAHYPESRVLIIMTGGTICMQPSADGLVPMTGFLENAMAPRPSFNDHT
APNVQLRAYKNGVKLTLDSLRTPVSAYSRHIRYGILEFTPLLDSSSISSIGWTEIALTIK
ENYHLFDGFVVLHGTDSLAYTASALSFMMSDLGKPVILTGSQASIFALQSDAVDNLLGSL
IIAGTFVIPEICLFFHHTLYRGNRTTKVSASSFEAFASPNCDPLAKVTSLGVDVHWALIR
RPTRIAEFQVTKYLDTAHVACLRIFPGIKPEMVDSVLRVPNLRGLILETFGMGNAPGGVD
GSLTKVIKEAIDRGIVIVNVSQCTNGFVSPLYAPGTVLGRAGVVFGHDLTTEAALTKLSY
LLALPDPTYSEVTAQMSHSLRGEMTEMALPSFSHPAGSIDSAMARLPAADAAFTALGYAI
RSGEVRTVREILEGDEFNHQLLKRADYVGNTPVHLAAVGPNPDILLELLTRGASVHPRNH
ANHTPLYLAEKMGNMETVKLLREAGAHLWRTEPHSGNASEAGDLASTTDVASVGAAEDEK
DVGVLAERESDEKEQKTSDQVADTVAPRRGSDKSSLVTDESLVHGLKKVDIGKFVN
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggttacgttcatggaagggaagaatcccgaggctcactaccccgagtcgagg
gtgctcatcatcatgacaggcggtacaatatgcatgcaaccgtctgcagatggtctggtt
cccatgacaggattcttggagaacgctatggcccctcgcccttcgttcaacgatcatacc
gctccgaatgttcagcttcgagcatacaagaacggggtcaagttgacgttggacagcctg
agaacaccagtcagcgcatattctcgtcatatccgatatggcatcctcgagtttactcca
ttgcttgactcaagctccatttcttccataggatggaccgagatcgcacttaccatcaag
gagaactatcacttgttcgacggctttgtggtattgcacggaaccgattccctggcgtac
accgcctcagccctttccttcatgatgtcggatctgggaaagccagtcattctgacagga
tcgcaagcctccatctttgccctccaatctgacgcagtcgacaacctcctcggctcgctc
atcattgcggggacgtttgttatccccgagatctgcctattctttcatcacaccttgtac
cgcggcaacaggacgaccaaggtatcggcttcttccttcgaggcattcgccagtcctaac
tgcgatccgttggccaaggtcacaagcttaggggtggatgttcactgggcgttgatacga
cggcccactcgaattgccgaatttcaagtgacaaaatacctcgacactgcacatgtggcc
tgtctgcgtatctttcccggaatcaaaccggagatggtcgattccgttcttcgagttcca
aacctccgtggtttgattcttgagacgttcggcatgggcaacgcaccgggcggcgttgat
ggcagtttgaccaaggttatcaaggaagcaatcgaccgtggcattgttattgtcaacgtg
agccagtgcacaaacggcttcgtttcgccactctatgcgcccggaaccgtactaggcaga
gcaggcgtggtatttggccatgatttaactaccgaggcggctctgacgaagctatcatac
cttctggcactgccagaccccacctactctgaggtcacggcacagatgtcgcactcgcta
cggggggagatgaccgaaatggcattgccctctttctcacaccctgcaggaagcattgat
tcggctatggcacggttgcctgctgcagacgccgctttcacggctcttggctacgccata
cgcagcggcgaggttcggactgttcgcgaaatcctcgagggtgacgagtttaaccatcag
ctacttaagagggctgattatgtcggcaacacccctgtgcatcttgctgcagttgggccc
aatccagatattcttcttgagttgctgactcgtggtgctagtgtacatccacgtaatcat
gcaaaccacacacctctttatcttgcagagaagatgggtaacatggagactgtaaagttg
ctcagggaggctggtgcgcacttgtggaggacagagccgcattcaggcaacgcatccgaa
gcaggggacctggcgagtacgacggatgttgcttcagttggtgccgcagaagatgagaaa
gatgtgggggtccttgctgaacgtgagtctgacgaaaaggagcagaagacaagtgatcag
gtggcagatacggtggcccctcggcgcggatcggataagagtagtctggttacagacgag
tctttggtccatgggctgaagaaagtggatattggcaagtttgtcaattag

DBGET integrated database retrieval system