KEGG   Sordaria macrospora: SMAC_02643Help
Entry
SMAC_02643        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
smp  Sordaria macrospora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1167 aa AA seqDB search
MGNPTTRALLTPSPSPPLDDRLANLAIGIKDEQNPDAPSPNSMLVDTPEEHIVEPNGVDN
DDVAIITPDADEKEAPVLANDFKTMKDHVLPALIDEPPILEDQVHTWEIKGWRSLNKKEH
GPVFQAGGFPWRILLFPYGNNVDQCSIYLEHGFEADEMPEKWSCCVQFALVLWNPNDPSV
FHHHSAHHRFTKEESDWGFTRFLELRRLFNQPYDGSTRPLGENDSVNISAYVRIVEDETG
VLWHNFNNYDSKQETGYVGLKNQGATCYLNSLLQSLYFTNAFRKIIYQIPTEQDESMMNS
AYTLQRLFYQLQTSNSAVATSELTKSFGWETRHIFEQQDVQELSRKLMERMEEKMKGTPH
EKALAQMFSGKIKTFISCINVPYESSRVEDFWDVQLNVSGNKNLLESFQDYIQVEKLDGE
NQYYAGDEYKLQDANKGVIFQSFPDVLHLQLKRFEYDIQRDTMMKINARYEFPEEFDAAP
FLEKDADRSEPWEYELHGVLVHSGDLNTGHYYAFLKPAKDGNWYKYDDDKVTKARKLEVL
EDNFGGPFRLPNGQIRTLPQKKTPIMRPNSAYMLVYIRKSRVDQILTPVTEEDTPPHLRN
RFAEELAAREARRKEREEQHLYIGVKAVTEATFQQHGGTDLTSFDATPDQDPGAPIYYRV
LRQDTLEQLVAKIAVDLGQDPRRVRLWIMVNRQNKTVRPDAPIMDLQLTVEETYSKATAQ
RDESLRVWAEVAEEVNADGEPIWPSYQAQANGAIVKDNILLFLKSFDVESQTLRGVGHVY
MSGEKIQLFEEIKPTMVEGLRGKETLKAEELQDGDIICFQRTHVHKSRLGLGESKPSEDA
KSSDKITDAREYYDFLFHRKVVRFCPHPQKADVQQYPQFELVLSSKMSYDKMSEKVGEHI
GVDPTHIRFYTINGANGNPRTAVKRLSNQTVERILTPPGYGQMNLNQLSDALYYEVLDIS
LAELDTKKSIKVTWLSEGITKEDQYDLLVTKSGVVEDLIEALVKKAKIPSEEEAGQIRVF
EVSNNKWYRDLDRTYPVISINEYTTVVAERKPEEEIGVTDPNQYITVFHFQNEPSRAHGM
SFRFLIKEGERFSETKKRLEKRLGIKGKSFEKIKFAVVRRAQFSRPIYLQDDDVLYDTAE
REDYLGLDHVDRSRSARNGGGDLFLKG
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccccactacccgcgctcttctgactccctcgccatccccgccacttgacgac
cggctcgctaatctggctattggcattaaggatgaacagaaccccgatgccccatcgccc
aactccatgctggttgatacacccgaggaacacatcgtcgaaccaaacggcgtcgataat
gacgatgtcgcaatcatcaccccggatgctgacgagaaggaggctcctgtcctcgccaat
gacttcaaaaccatgaaagatcacgtccttccggccctaatcgacgaacccccaatcctt
gaggatcaggttcacacatgggagatcaagggttggcgcagcctaaacaagaaggagcat
ggccccgtcttccaggccggtggcttcccatggcggatccttcttttcccatatggcaac
aatgttgatcaatgttcgatatacctggaacacggattcgaagccgacgagatgcccgag
aaatggagctgctgcgtccagtttgcgctagtgctatggaatcccaacgacccgtccgtc
tttcaccaccattccgcccatcaccgcttcactaaggaggagagcgattgggggtttaca
cggtttttggaactccggaggctgttcaaccagccttatgacggttcaacccgtcctctg
ggcgaaaacgacagcgtcaacatcagcgcctacgtcaggattgtcgaggatgaaacagga
gttttgtggcacaacttcaacaactacgattcgaagcaggagacaggctatgttggcctt
aaaaaccagggcgccacttgctatttgaactcgctcttacagtcgctctatttcacgaat
gctttccgcaagattatctaccagatccctaccgagcaagacgagagcatgatgaacagc
gcctatactctacaacgactcttttatcagttgcaaacatcaaatagcgccgtggctacc
agtgagcttaccaagtcttttggatgggaaactcgtcatattttcgaacagcaagacgtc
caggaactctcgcggaaactgatggaacgcatggaggagaagatgaagggcacaccgcac
gagaaagccctggcacagatgttcagcggtaagatcaaaacattcatctcctgcatcaac
gttccgtacgaatccagccgagttgaggatttctgggacgtccaactcaacgtcagcggc
aacaagaatctgctggagagtttccaggactacattcaggtggagaaattggatggcgaa
aaccaatactatgctggcgacgagtacaagctccaggatgccaacaagggcgtcattttc
cagagctttcccgatgtcctgcatctgcagctgaaacgcttcgaatacgacatccagcgc
gacaccatgatgaagatcaatgctcgctacgagtttcccgaggagttcgatgccgccccc
ttcctcgagaaagacgccgaccgatcggaaccttgggaatacgagcttcatggtgtgctg
gtgcacagcggagaccttaacaccggccactattacgctttcttgaagcccgccaaggac
ggaaattggtacaagtacgatgatgataaagtcaccaaggccaggaagcttgaggtcttg
gaagacaactttggcggtcctttccggctgcccaatggacaaattaggactttgccgcaa
aagaagacgccaatcatgcggcccaacagcgcctacatgctcgtgtatatccgcaagtcc
cgcgtcgatcaaatccttaccccggttaccgaggaggacacgcctccacatctccgcaac
aggttcgcagaggagctggctgctcgcgaagctcgacgcaaagagagggaggaacagcac
ctttacattggggtaaaggccgtcaccgaggcgacgttccagcaacacggcggtaccgat
ctgacctccttcgacgcgactcctgaccaagatcccggggcaccaatttattaccgtgtt
cttcgccaggataccttggagcagttggttgccaaaattgcagtcgacctcggacaagat
cctagacgtgttcgtttgtggataatggtcaatcgtcaaaacaagacggttcgcccggat
gctccgattatggatcttcagcttacagtggaggaaacttattccaaggctactgcgcag
agggatgagtccttgcgcgtgtgggctgaagtggctgaggaggtcaacgcggacggcgaa
cccatctggccatcgtaccaggcgcaagctaacggcgctattgtcaaggacaacatcttg
ttgtttttgaaatcgttcgacgtggagagccagacgttgaggggagtcgggcatgtctac
atgagtggggagaagattcaactctttgaggagatcaagccaaccatggtagagggactg
cggggcaaggaaaccctcaaggccgaggagttgcaggacggagacataatatgtttccaa
cgaacccatgtgcacaagtcaagacttggtcttggcgagagcaagccttctgaagacgcc
aaatcctcggacaagatcacggatgccagggaatattacgatttcttgttccatcggaag
gtcgttaggttttgcccccacccccaaaaggctgatgtccagcagtaccctcagtttgag
cttgtcttgagttccaagatgagctatgacaaaatgtcggagaaggtcggagagcacata
ggtgttgatcctactcatatccgattctataccatcaacggcgccaatggtaatcccagg
acggctgtgaagaggttatccaaccaaacggtagagaggatccttaccccgccgggatac
gggcagatgaatctcaatcaactgtcagacgcactttactatgaagtccttgacattagt
cttgctgagctagacaccaagaagagcatcaaggtcacttggctcagtgagggcatcaca
aaagaggatcaatacgatcttcttgtaaccaagagtggtgtggttgaggacctcatcgag
gcgttggtcaagaaggccaagattcccagtgaagaggaggccggccaaatccgagtattc
gaggtcagcaacaacaagtggtacagggatctcgacaggacttaccctgtcatctcgatt
aacgaatacaccaccgttgtggccgaacggaaacccgaggaagagattggtgttactgat
cctaaccagtacataactgtcttccacttccaaaatgaaccaagcagggctcacggaatg
tcgttcagattcttgatcaaagagggcgagcggttttcggagactaagaagcggcttgaa
aagagattgggaatcaagggcaagagcttcgagaagatcaagttcgctgtggtcagacgg
gcacagttctcaagaccaatctatctccaagacgatgacgtcctgtacgatacggccgag
cgagaagactaccttggcttggatcatgttgatcggtcaaggtctgcgcgaaatggcggt
ggtgacttgttccttaagggataa

DBGET integrated database retrieval system