KEGG   Sordaria macrospora: SMAC_02674Help
Entry
SMAC_02674        CDS       T01610                                 

Definition
calcineurin subunit B protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
smp  Sordaria macrospora
Brite
Protein phosphatases and associated proteins [BR:smp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     SMAC_02674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 237 aa AA seqDB search
MGNTTSSVLDNIVQGSNFDREEVDRLRKRFMKLDKACSTPTISVLLPYIHRNRWRKSANT
NWSGQDHGDNSGTIEREEFLSLPQISTNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSS
KGNKEQKLRFAFKVYDIDRDGYISNGELFIVLKMMVGSNLKDQQLQQIVDKTIMEADLDK
DGKISFEEFTKMVENTDVSMSMTLGEFLLLDLFPPDWLMVKLASVGPLAIDIRKTKS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaccaccagctccgtcctggacaacattgtccagggatccaacttcgacagg
gaagaggttgaccgcttgcgcaagaggtttatgaagttggacaaggcatgttctacacca
accatttccgtccttctaccttatatacacagaaaccgttggcgcaagtcagcgaataca
aattggagcggtcaagatcatggtgataactcgggtaccattgagcgcgaagagttcttg
agcctaccgcaaatatcgacgaaccctctggccaccagaatgattgccatcttcgacgaa
gacggtggcggtgacgttgactttcaagaattcgtatctggtctgagcgccttctcgagc
aaaggcaacaaggagcagaagctgcggttcgccttcaaggtgtacgacattgaccgtgac
ggctacatcagcaacggcgagctctttatcgtgctgaagatgatggtgggcagcaatctc
aaggaccagcagctgcagcagattgtcgacaagaccatcatggaggcggatctcgacaag
gacggcaagatcagctttgaggagttcactaagatggtggagaacacggatgtcagcatg
agcatgactttgggtgagtttctgctccttgacttgtttccccccgactggctgatggtc
aagcttgcctctgttgggccccttgctattgatatccggaagaccaaaagctaa

DBGET integrated database retrieval system