KEGG   Sordaria macrospora: SMAC_02674Help
Entry
SMAC_02674        CDS       T01610                                 

Definition
(RefSeq) calcineurin subunit B protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
smp  Sordaria macrospora
Brite
Protein phosphatases and associated proteins [BR:smp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     SMAC_02674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 10809868
NCBI-ProteinID: XP_003352239
UniProt: F7VX54
AA seq 237 aa AA seqDB search
MGNTTSSVLDNIVQGSNFDREEVDRLRKRFMKLDKACSTPTISVLLPYIHRNRWRKSANT
NWSGQDHGDNSGTIEREEFLSLPQISTNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSS
KGNKEQKLRFAFKVYDIDRDGYISNGELFIVLKMMVGSNLKDQQLQQIVDKTIMEADLDK
DGKISFEEFTKMVENTDVSMSMTLGEFLLLDLFPPDWLMVKLASVGPLAIDIRKTKS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaccaccagctccgtcctggacaacattgtccagggatccaacttcgacagg
gaagaggttgaccgcttgcgcaagaggtttatgaagttggacaaggcatgttctacacca
accatttccgtccttctaccttatatacacagaaaccgttggcgcaagtcagcgaataca
aattggagcggtcaagatcatggtgataactcgggtaccattgagcgcgaagagttcttg
agcctaccgcaaatatcgacgaaccctctggccaccagaatgattgccatcttcgacgaa
gacggtggcggtgacgttgactttcaagaattcgtatctggtctgagcgccttctcgagc
aaaggcaacaaggagcagaagctgcggttcgccttcaaggtgtacgacattgaccgtgac
ggctacatcagcaacggcgagctctttatcgtgctgaagatgatggtgggcagcaatctc
aaggaccagcagctgcagcagattgtcgacaagaccatcatggaggcggatctcgacaag
gacggcaagatcagctttgaggagttcactaagatggtggagaacacggatgtcagcatg
agcatgactttgggtgagtttctgctccttgacttgtttccccccgactggctgatggtc
aagcttgcctctgttgggccccttgctattgatatccggaagaccaaaagctaa

DBGET integrated database retrieval system