KEGG   Sordaria macrospora: SMAC_02703Help
Entry
SMAC_02703        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
smp  Sordaria macrospora
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:smp00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 385 aa AA seqDB search
MSFSSLVQDLSLRDPNAPRRRGDASVSTIDDRASRTSHISRAMSYASTAATSVSIAGDIS
SQLHGGYAHPLARSWQAERQLTKSMLIYPLFVSDNDDEEVLIPSLPNQYRRGINRLVPFL
EPLVHKGLRSVILFGVPLKPGTKDALGTSADDPEGPVIKSIRLLRQRFPQLYISVDVCLC
EYTSHGHCGILRDDGSLNNQLSVDRISDVALAYAKAGAHCVAPSDMNDGRIRAIKLKLIE
EGIVHRVTLMSYAAKFSGCLYGPFRDAAGSCPSFGDRKCYQLPPGGRGLARRAIVRDINE
GADIIMVKPASQYLDIISDAKELGKDLPIAAYQVSGEFAMIHAAAKAGVFDLKAMAFEAT
EGILRAGATIIISYFVPEFLDWLST
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctccagccttgtacaagatctctcgctccgggaccccaatgcgcccaggcgc
cgcggtgacgcttctgtctctaccatcgacgaccgcgcttctcgcacttcccacatctcc
cgcgccatgtcctatgccagcaccgccgccacgagcgtcagcatcgccggcgacatctcc
agccagctccatggcggttatgcccatccccttgcccgctcatggcaggccgagcgtcaa
ctaacaaagtccatgctcatctaccccctattcgtttccgacaacgacgatgaagaggtt
cttatcccttctctcccgaaccaataccgccgtggcatcaacagacttgttcccttcctc
gagccgctcgttcacaagggccttcgctccgtcattctcttcggtgttcctctcaagccc
ggtaccaaggatgctcttggaacctctgccgatgatccggagggtcccgtcatcaagagt
atccgcctcttgaggcaaagattccctcagctctacatcagtgtcgacgtctgcctgtgc
gagtacacttcacacggccactgcggtattttgcgcgatgacggcagtctcaacaaccaa
ttgtcggtcgatcgtatctcggacgttgctcttgcctatgccaaggccggcgcccactgc
gttgctccttccgacatgaatgacggtcgcattcgtgccatcaagctgaagcttatcgag
gagggtattgtccaccgtgtgactctcatgtcgtacgccgccaagttctcaggctgcctt
tacggccccttccgtgacgctgccggctcatgcccttcctttggcgaccgcaagtgctac
cagctacctcccggaggccgcggtctggctcgtcgtgccattgttcgtgacatcaacgag
ggtgccgatatcatcatggtcaagcccgcaagccagtacctggacattatcagtgacgcc
aaggagctcggaaaggacttgcctattgctgcctaccaggttagcggtgaattcgccatg
atccacgccgccgcaaaggccggtgtgttcgatctcaaggctatggcctttgaagccacc
gagggtattctccgggctggcgccaccatcatcatcagctacttcgtccccgagttcctt
gactggctctccacatga

DBGET integrated database retrieval system