KEGG   Sordaria macrospora: SMAC_02871Help
Entry
SMAC_02871        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
smp  Sordaria macrospora
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:smp00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 634 aa AA seqDB search
MHLSSSLLIAAPLLATVSAEPIRIPQRDVSLVSTSQELAIRALPDSPSGGYAPAVVDCPK
TKPTLRKALDLSKEEKDWVSTRRKNTIQPMRDLLKRANINGFNAEAFMNEAAKNISQLPN
VAIAVSGGGYRALMNGAGFVAAADNRIKDTTGAGGIGGLLQSSTYLAGLSGGGWLVGSLF
SNNFSSVESLLSENKVWDFENSIFKGPKEAGISTVNRIQYWSEVAKEVAKKKDAGFETSI
TDYWGRALSYQLIGDDLGGPAYTFSSIAQTDHFKKADTPFPILVADGRAPGETIISLNAT
NFEFNPFEMGSWDPTVFGFVPTKYIGANFTNGVIPSGGKCVQGLDQAGFVMGTSSTLFNQ
FLLANITSYEGVPDILIKAVTSILEDIGESKNDVSQIIPTLDGGEDLQNIPLNPLIQPVR
AVDVIFAVDSSADVTNWPNGTALRATYERTFGAISNGTLFPTIPDDWTFVNLGLNNRPSF
FGCDVKNFTFDANFKNQTVPPLIVYVPNAPYTALSNVSTFDPSYTMSQRNDIIGNGWNSA
TQGNGTLDKEWPTCVACAVISRSLDRLGRQTPAACKTCFERYCWNGTVDSRDTGVYMPQW
KIADAHAEDSGAIGKMVNVWSSVVVGVVAAVLLL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgcatctctcatcgtcgctgctcatcgcagctcccttgctcgccaccgtatcggccgaa
cctatcaggataccccagcgcgatgtctccctggtatcaacatcacaggaacttgccatc
cgagcactcccggattcgcccagcggtgggtacgccccggccgttgtagactgtcccaag
accaaaccgacactccggaaggccctggatctctcgaaggaggagaaggactgggtatcg
acgcggaggaagaacacgatccagcccatgagggacctgctgaagagggccaacatcaac
gggttcaatgccgaggcttttatgaacgaggccgccaagaacatctcgcaactgcccaat
gtcgccatcgctgtctcgggtggtggctaccgcgccctcatgaacggcgccggtttcgtt
gctgcagcggataaccggatcaaggataccacgggcgcgggtggcatcggaggcttgttg
cagtccagcacgtatttggctggactttccggcggtggctggctcgttggcagtttgttc
tccaacaacttcagcagcgtagagagcctgctgagcgagaacaaagtttgggactttgag
aattccatcttcaagggacccaaggaggctggcattagtactgtcaaccgcatccagtac
tggtccgaagtggccaaggaagttgcgaagaagaaggatgccggcttcgagaccagtata
acagactactggggccgagcattgagttaccaactgatcggagacgacttgggcggaccc
gcgtacaccttctccagcattgcccagaccgaccacttcaagaaggccgacacgcccttc
cctatcttggtagctgacggtcgcgcgccgggagagaccatcatctcgctcaacgctact
aacttcgagtttaaccccttcgagatgggcagctgggacccgaccgtcttcggctttgtg
ccgaccaagtacatcggcgccaacttcaccaacggtgtgatcccctcgggcggcaagtgc
gtccagggtctcgaccaagccggcttcgtcatgggcacgagcagcacgctcttcaaccag
ttcctgctggccaacatcaccagctacgaaggcgtgccggacatactcatcaaggccgtg
acctccattctcgaggacatcggcgagagcaagaacgatgtctcccaaatcatcccaacc
ctcgacggcggcgaggacctgcagaacatcccgctcaacccgctcatccagcccgtccgc
gccgtggacgtcatcttcgccgtcgactcttccgcggacgtgaccaactggcccaacggc
accgccctgcgcgccacctacgagcgcaccttcggcgccatctccaacggcactttattc
cctacgatccccgacgactggacctttgtgaacctcggcctcaacaaccgtccctctttc
ttcggctgcgacgtcaagaacttcaccttcgacgccaacttcaaaaaccagacggtcccg
cccctgatcgtctacgtccccaacgcgccttacacggcgcttagcaacgtgtccaccttc
gatccgtcgtacaccatgtcgcagcgcaacgacatcattggcaacgggtggaactcggcc
acgcagggcaacggcacgctggacaaggagtggcctacttgcgtcgcgtgcgcggttatc
agcaggagcttggatcggttgggacggcagacgccggcggcgtgcaagacgtgctttgag
aggtattgctggaatggcacggtggattcgagggatacgggggtttacatgcctcagtgg
aaaattgcggatgcgcatgcggaggattcgggagctattgggaagatggtgaatgtttgg
tcgtcggttgttgtgggagttgtagcggctgttttgctgttgtaa

DBGET integrated database retrieval system