KEGG   Sordaria macrospora: SMAC_03043Help
Entry
SMAC_03043        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
smp  Sordaria macrospora
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMAC_03043
Enzymes [BR:smp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     SMAC_03043
Exosome [BR:smp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SMAC_03043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 262 aa AA seqDB search
MDISDFDRSRIYLSWEVNGKFHSDGREVALLEYIYNRPDIDQLRGNPQKVLQAIDDFARS
VTGLINIGETKGAVVTDLIAQHKPDTILELGGYVGYSAIMFGDALRKAGGKQYHSVEKSP
LFAAVAASLVDLAGLRDVVRITVGTGAEGTQRLYDLGVLKSQLAMAFFDHHKPSYTSDLK
RCERLGLVGPGTVLVADNMILPGNPPYAEWVRAGVAKKRELDKNSEEKGNPNLQYKSRSI
KSWEPSGHEDALEITECVGIEA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggacatttcggatttcgaccgctccagaatctacctgagctgggaagtgaacggcaaa
tttcatagtgatggccgcgaggttgcccttctcgagtacatttacaaccgtcccgacatt
gaccagcttcgtgggaacccacaaaaggtcctacaggccatcgatgactttgcccgctct
gtcaccggcctaatcaacattggcgagacgaaaggtgctgttgtcacggacctcattgcc
caacataagcctgacaccatcctcgagctgggcggctatgtcggttactctgccatcatg
tttggcgatgccctgagaaaagctggcggaaaacaataccatagcgtcgaaaagagcccc
ctctttgccgctgttgccgcaagcctcgtcgacttggctggcctcagggatgtcgtcagg
atcaccgtcggcaccggtgccgagggtactcaacgcctttacgatttgggagtgctcaag
tcccagcttgccatggccttctttgaccatcacaagccaagctacaccagtgatctaaag
cggtgcgagagactgggtcttgtcggtccaggcaccgtcttagtcgccgacaacatgatc
ttaccggggaatccaccatatgctgagtgggttagagccggtgttgccaagaagcgagag
cttgacaagaattccgaagaaaagggtaaccctaatctgcaatacaagagcaggtccatc
aagagttgggagccgagtggccatgaagacgcactggagataaccgagtgcgtgggcatt
gaagcttga

DBGET integrated database retrieval system