KEGG   Sordaria macrospora: SMAC_03043Help
Entry
SMAC_03043        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
smp  Sordaria macrospora
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:smp00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 262 aa AA seqDB search
MDISDFDRSRIYLSWEVNGKFHSDGREVALLEYIYNRPDIDQLRGNPQKVLQAIDDFARS
VTGLINIGETKGAVVTDLIAQHKPDTILELGGYVGYSAIMFGDALRKAGGKQYHSVEKSP
LFAAVAASLVDLAGLRDVVRITVGTGAEGTQRLYDLGVLKSQLAMAFFDHHKPSYTSDLK
RCERLGLVGPGTVLVADNMILPGNPPYAEWVRAGVAKKRELDKNSEEKGNPNLQYKSRSI
KSWEPSGHEDALEITECVGIEA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggacatttcggatttcgaccgctccagaatctacctgagctgggaagtgaacggcaaa
tttcatagtgatggccgcgaggttgcccttctcgagtacatttacaaccgtcccgacatt
gaccagcttcgtgggaacccacaaaaggtcctacaggccatcgatgactttgcccgctct
gtcaccggcctaatcaacattggcgagacgaaaggtgctgttgtcacggacctcattgcc
caacataagcctgacaccatcctcgagctgggcggctatgtcggttactctgccatcatg
tttggcgatgccctgagaaaagctggcggaaaacaataccatagcgtcgaaaagagcccc
ctctttgccgctgttgccgcaagcctcgtcgacttggctggcctcagggatgtcgtcagg
atcaccgtcggcaccggtgccgagggtactcaacgcctttacgatttgggagtgctcaag
tcccagcttgccatggccttctttgaccatcacaagccaagctacaccagtgatctaaag
cggtgcgagagactgggtcttgtcggtccaggcaccgtcttagtcgccgacaacatgatc
ttaccggggaatccaccatatgctgagtgggttagagccggtgttgccaagaagcgagag
cttgacaagaattccgaagaaaagggtaaccctaatctgcaatacaagagcaggtccatc
aagagttgggagccgagtggccatgaagacgcactggagataaccgagtgcgtgggcatt
gaagcttga

DBGET integrated database retrieval system