KEGG   Sordaria macrospora: SMAC_03142Help
Entry
SMAC_03142        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
smp  Sordaria macrospora
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SMAC_03142
  Replication and repair
   03420 Nucleotide excision repair
    SMAC_03142
Transcription machinery [BR:smp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SMAC_03142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 427 aa AA seqDB search
MASEDARYRETSQFEAWSFSPAQLAAMREKTNALARRRIAERMLASALNPPTSNNTSHAN
TPDPSGNGTPNPNENGAPTLPDFLKPEEEALLVSFYVSELLRAADHLGVPDEVRATATVF
FRRFFLTNSIMTYPPQEMILVALFVGSKAEGRFPRIIEFQQKFNTKQDILAGEFLLCQGN
RFNFEVRHPFRALMGAMMELRSYGDIDEQRIIAAEKRAHGILLFSPLMTDAYFHYTPSQI
MFAALSLADRGLAERLIQETFHFVPPTTNNDSTPAQTPLPGSENLGTARKDGGGKGQMTN
DERAAIIGTGIRDKVMGTIEACRNMLSNELPERKSHWTSESIFKSQIRPVRKKLTKCRDP
DRWNLSELQRQRREQGLKREDSEERAATSKGSKDPALFGGDLVAGAPEKKRRKVDGNGLE
DPFGGPL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggaagatgcgcgataccgcgagacatcgcagttcgaagcatggtccttctcg
cccgctcagctcgctgccatgcgcgagaagaccaacgccctcgcccgccgaagaatcgcc
gagcgcatgctggcatcagctttgaatccaccaacatcgaacaatacatcgcatgcgaac
acgccagacccgtctggaaatgggacgcccaaccctaacgagaacggcgcaccgacctta
cccgacttcctcaagcctgaagaagaggccttgctcgtgtccttttacgtatccgaacta
ttgcgcgcggcggaccatcttggagtgccagacgaagtcagggcgacagctacggtcttt
ttcaggaggttcttcctgacgaatagcatcatgacgtacccaccacaggagatgatcctt
gtggcgctgtttgtcggaagcaaggcggagggaaggtttcctcggattattgagtttcaa
caaaagttcaacacgaagcaggatatcctcgctggcgaattcctgctttgtcagggaaac
aggttcaactttgaggtcagacacccgtttagggcgctgatgggggcgatgatggagttg
aggagctacggggacatcgacgaacaacgcataatagcagccgaaaagcgcgcccacggg
attctactcttcagccctctcatgaccgacgcctacttccactacacaccgtcgcagata
atgtttgcagcattatcccttgcagatcgtggactggctgagcgcctgatccaggagact
ttccactttgtcccaccgactaccaacaacgatagcactcctgcccagacaccactacct
ggttccgaaaacttggggacagcccgaaaggatggtggtggcaaggggcaaatgactaac
gatgagcgtgcagccattatcggcacgggaatccgagataaggttatgggcactatcgag
gcatgcaggaacatgctgtctaacgaactgccggaaaggaagtcgcattggactagtgaa
tcaatcttcaaatcccaaattcggcccgtccgtaagaagctgacgaagtgccgcgacccc
gaccgctggaacctgtctgagctccagcgccaacgccgcgagcaaggactcaaacgagag
gattcagaggaacgcgctgctaccagcaaggggagcaaagatcctgctctctttggcggc
gacctggtagctggcgcaccagagaagaagaggaggaaggtcgatgggaatgggttggaa
gacccctttggaggcccactttga

DBGET integrated database retrieval system