KEGG   Sordaria macrospora: SMAC_03202Help
Entry
SMAC_03202        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
smp  Sordaria macrospora
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMAC_03202
Enzymes [BR:smp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SMAC_03202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 595 aa AA seqDB search
MKFTSTLALGLSVVVDGTLGAKIPQGPKTTCPPGASFKKLSAQAFMDAATPGWNLGNTLD
AVPDEGSWNNPIFQANALDVVKSAGFKSVRIPVTYSDHFLLPNSLTNHTISPQWLDRVST
VIDMATSRGLLVVTNMHHDSWAWADVSSSGGKNTTLIREKFYAGWLQIATKLACKPSTVA
FEPINEPPGSTAEDAERLMGLNDLFIHALRDSGGWNSQRVVTLSALNMGGADRMQNGWFR
LPKNMTNPWAFQFHYYSPYDFIFQAWGKTVWGSESDKVAVVADLEAVRGNLTAITNDPKV
PIYLGEFDASQLSLEAAARWRWFDTVVSAARRLNIVPVLWDNGLDNLQRETGRWRDEVAV
EIIVNAIKGKKNSLPESTTDGGATTQESSAYVFNKVGEDIGAEGRNLSFALNGNRFKALS
VGGVPLKAGKDYAVQEQGTVTLKKEFLGKYLSRDAAPGTKANITVTFSAGAKSRVEIVQW
DLPVPAQTISSGSAVPAGQDLSVPVVWKGLHRVAAVKMIKADGSYLFDDWTMWLPGLQKG
CGTYGGQWDFDFDKLIIRRQTLDAVIASGQSATLTFEFYPRAAGNGNYLNYTLTV
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcacgagtactttggccttgggcctctcggtggttgttgatggcacgctgggg
gcaaagataccgcagggaccgaagacgacatgtccgcccggtgctagcttcaagaagctc
tcggcgcaagccttcatggacgccgcgactcctgggtggaatctcggaaacacacttgac
gccgttcccgacgaaggatcatggaataaccccatcttccaggccaatgcgcttgacgtg
gtcaaatcagctgggttcaagtctgttcggattcctgtaacctactccgaccacttcttg
ttgcctaactctctaacaaaccacaccatttctccccaatggctcgaccgcgtctccacc
gtaatcgacatggccacgtcgcgggggcttttggtcgtaacaaacatgcaccacgactcc
tgggcctgggccgacgtctcttcttcgggaggtaaaaacaccactctcatccgcgaaaag
ttctacgccggctggctgcaaatcgctaccaaactcgcctgcaagccctccaccgtagca
ttcgagcccatcaacgagcctcccggttccacggctgaagatgccgaaagactaatgggt
cttaacgacctgtttatccacgccctgagggattctggcgggtggaattcccagagagtg
gtaaccctgtcagcgctgaacatggggggtgctgatcgcatgcaaaatgggtggtttagg
ttgccgaagaacatgacgaacccgtgggctttccagttccactattactcgccttacgac
ttcattttccaagcgtgggggaagacggtctggggaagtgagagcgataaagtggctgtg
gtggcggatctggaagctgtgaggggaaatctgacggcgattactaatgacccgaaagtg
ccgatttatctgggcgagttcgatgcgagccagttgagtctcgaggctgccgctaggtgg
cggtggtttgataccgtcgtgtcagctgcgaggaggctgaatattgttccggtgctgtgg
gataatggactggataatttgcagagggagacggggcggtggagggatgaagtcgcggtg
gagattattgttaatgccatcaagggcaaaaagaattcgttgccggaaagtacgacggat
ggtggcgcgacgacgcaggagagctcggcgtatgtttttaataaggttggggaggatatc
ggggcagaggggaggaacttgtcgtttgcgttgaatgggaaccggtttaaggcgttgagt
gttggcggggtgccgctcaaggctggaaaggattatgcggtccaggagcaggggacggtg
accctcaagaaggagttcctgggcaagtatctctccagggacgcggcgccgggaaccaag
gcgaatatcacggttacgttctcggctggcgcgaagagtcgggtggagatcgtccagtgg
gatttgccggtgccggcacagacgatctcctcggggagcgcggtgccggcgggtcaagat
ttgtcggttccggtggtctggaaggggctgcatcgggtggcggcggtgaagatgatcaag
gcggatgggtcgtacctgtttgatgactggaccatgtggttgcctgggctgcagaagggc
tgtggtacatatggtggccagtgggacttcgacttcgacaagctcatcatccggaggcag
acgctggatgccgtgattgcttcaggccaaagtgccacgctcacgttcgagttctatccg
cgtgcggcagggaacgggaattacttgaattataccctgaccgtttga

DBGET integrated database retrieval system